PSQ00730 FD00427 Alpha-2-HS-glycoprotein
P02765 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
40
cysteine-type endopeptidase inhibitor activity, endopeptidase inhibitor activity, kinase inhibitor activity
367
Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A
AHSG
9606
blood microparticle, collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, platelet alpha granule lumen, secretory granule lumen
acute-phase response, cellular protein metabolic process, negative regulation of bone mineralization, negative regulation of endopeptidase activity, negative regulation of insulin receptor signaling pathway, neutrophil degranulation, pinocytosis, platelet degranulation, positive regulation of phagocytosis, post-translational protein modification, regulation of bone mineralization, regulation of inflammatory response, skeletal system development
6833285 40
301:340
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTR
PSQ00732 FD00042 Osteocalcin
P02818 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
28
calcium ion binding, hydroxyapatite binding, structural constituent of bone, structural molecule activity
100
Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
BGLAP
9606
cytoplasm, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, perikaryon, rough endoplasmic reticulum, vesicle
bone development, bone mineralization, cell adhesion, cell aging, cellular response to growth factor stimulus, cellular response to vitamin D, endoplasmic reticulum to Golgi vesicle-mediated transport, odontogenesis, osteoblast development, osteoblast differentiation, regulation of bone mineralization, regulation of bone resorption, regulation of cellular response to insulin stimulus, regulation of osteoclast differentiation, response to activity, response to drug, response to estrogen, response to ethanol, response to glucocorticoid, response to gravity, response to hydroxyisoflavone, response to mechanical stimulus, response to testosterone, response to vitamin D, response to vitamin K, response to zinc ion, skeletal system development
6967872 28
24:51
KPSGAESSKGAAFVSKQEGSEVVKRPRR
PSQ00749 FD00039 Interstitial collagenase
P03956 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
80
endopeptidase activity, metalloendopeptidase activity, peptidase activity, serine-type endopeptidase activity, zinc ion binding
469
Fibroblast collagenase, Matrix metalloproteinase-1
MMP1
9606
extracellular matrix, extracellular region
cellular protein metabolic process, cellular response to UV-A, collagen catabolic process, cytokine-mediated signaling pathway, extracellular matrix disassembly, extracellular matrix organization, leukocyte migration, positive regulation of protein-containing complex assembly, proteolysis, viral process
2557822 80
20:99
FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQ
PSQ00753 FD00010 Phospholipase A2
P04054 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
7
bile acid binding, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), signaling receptor binding
148
Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B
PLA2G1B
9606
cell surface, extracellular region, extracellular space, secretory granule
actin filament organization, activation of MAPK activity, activation of phospholipase A2 activity, antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, arachidonic acid secretion, cellular response to insulin stimulus, defense response to Gram-positive bacterium, fatty acid biosynthetic process, innate immune response in mucosa, intracellular signal transduction, leukotriene biosynthetic process, lipid catabolic process, neutrophil chemotaxis, neutrophil mediated immunity, phosphatidic acid biosynthetic process, phosphatidylcholine acyl-chain remodeling, phosphatidylcholine metabolic process, phosphatidylethanolamine acyl-chain remodeling, phosphatidylglycerol acyl-chain remodeling, phosphatidylglycerol metabolic process, phosphatidylinositol acyl-chain remodeling, phosphatidylserine acyl-chain remodeling, positive regulation of calcium ion transport into cytosol, positive regulation of cell population proliferation, positive regulation of fibroblast proliferation, positive regulation of glomerular visceral epithelial cell apoptotic process, positive regulation of immune response, positive regulation of interleukin-8 production, positive regulation of NF-kappaB transcription factor activity, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, regulation of glucose import, signal transduction
6349696 7
16:22
DSGISPR
PSQ00784 FD00052 Corticoliberin
P06850 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
129
corticotropin-releasing hormone activity, corticotropin-releasing hormone receptor 1 binding, corticotropin-releasing hormone receptor 2 binding, hormone activity, neuropeptide hormone activity, signaling receptor binding
196
Corticotropin-releasing factor, Corticotropin-releasing hormone
CRH
9606
cytoplasm, extracellular region, extracellular space, perikaryon, synapse, varicosity
associative learning, cellular response to cocaine, cellular response to dexamethasone stimulus, chemical synaptic transmission, diterpenoid metabolic process, female pregnancy, G protein-coupled receptor signaling pathway, hormone-mediated apoptotic signaling pathway, hypothalamus development, inflammatory response, ion homeostasis, learning or memory, long-term synaptic potentiation, negative regulation of cell death, negative regulation of circadian sleep/wake cycle, REM sleep, negative regulation of epinephrine secretion, negative regulation of gene expression, negative regulation of glucagon secretion, negative regulation of inflammatory response to antigenic stimulus, negative regulation of luteinizing hormone secretion, negative regulation of norepinephrine secretion, negative regulation of systemic arterial blood pressure, parturition, positive regulation of behavioral fear response, positive regulation of calcium ion import, positive regulation of cAMP-mediated signaling, positive regulation of cell death, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, wakefulness, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of digestive system process, positive regulation of gene expression, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of protein phosphorylation, regulation of NMDA receptor activity, regulation of serotonin secretion, response to corticosterone, response to drug, response to estrogen, response to ethanol, response to ether, response to immobilization stress, response to pain, signal transduction, steroid metabolic process, synaptic transmission, dopaminergic
3262120 129
25:153
LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERR
PSQ00785 FD00217 Beta-hexosaminidase subunit alpha
P06865 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
66
acetylglucosaminyltransferase activity, beta-N-acetylhexosaminidase activity, N-acetyl-beta-D-galactosaminidase activity, protein heterodimerization activity
529
Beta-N-acetylhexosaminidase subunit alpha, N-acetyl-beta-glucosaminidase subunit alpha
HEXA
9606
azurophil granule, cytosol, extracellular exosome, intracellular membrane-bounded organelle, lysosomal lumen, membrane
carbohydrate metabolic process, chondroitin sulfate catabolic process, ganglioside catabolic process, glycosaminoglycan biosynthetic process, glycosphingolipid metabolic process, hyaluronan catabolic process, keratan sulfate catabolic process
2965147 66
23:88
LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRH
PSQ00794 FD00004 Prostate-specific antigen
P07288 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
7
endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity, serine-type peptidase activity
261
Gamma-seminoprotein, Kallikrein-3, P-30 antigen, Semenogelase
KLK3
9606
extracellular exosome, extracellular region, extracellular space, nucleus, protein-containing complex, secretory granule
cellular protein metabolic process, negative regulation of angiogenesis, positive regulation of antibacterial peptide production, proteolysis, regulation of androgen receptor signaling pathway, regulation of systemic arterial blood pressure, zymogen activation
2422647, 3691515 7
18:24
APLILSR
PSQ00795 FD00527 Complement component C8 beta chain
P07358 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
22
protein-containing complex binding
598
Complement component 8 subunit beta
C8B
9606
extracellular exosome, extracellular region, extracellular vesicle, membrane, membrane attack complex
complement activation, complement activation, alternative pathway, complement activation, classical pathway, cytolysis, immune response, regulation of complement activation
3651397 22
33:54
ERPHSFGSNAVNKSFAKSRQMR
PSQ00800 FD00382 Decorin
P07585 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
14
collagen binding, extracellular matrix binding, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding, protein N-terminus binding, RNA binding
360
Bone proteoglycan II, PG-S2, PG40
DCN
9606
collagen type VI trimer, collagen-containing extracellular matrix, extracellular region, extracellular space, Golgi lumen, lysosomal lumen
aging, animal organ morphogenesis, chondroitin sulfate biosynthetic process, chondroitin sulfate catabolic process, dermatan sulfate biosynthetic process, extracellular matrix organization, kidney development, negative regulation of angiogenesis, negative regulation of endothelial cell migration, negative regulation of vascular endothelial growth factor signaling pathway, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan, placenta development, positive regulation of autophagy, positive regulation of macroautophagy, positive regulation of mitochondrial depolarization, positive regulation of mitochondrial fission, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of transcription by RNA polymerase II, response to lipopolysaccharide, response to mechanical stimulus, skeletal muscle tissue development, wound healing
2590169, 3597437 14
17:30
GPFQQRGLFDFMLE
PSQ00805 FD00217 Beta-hexosaminidase subunit beta
P07686 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
79
acetylglucosaminyltransferase activity, beta-N-acetylhexosaminidase activity, identical protein binding, N-acetyl-beta-D-galactosaminidase activity
556
Beta-N-acetylhexosaminidase subunit beta, Cervical cancer proto-oncogene 7 protein, N-acetyl-beta-glucosaminidase subunit beta
HEXB
9606
acrosomal vesicle, azurophil granule, azurophil granule lumen, cortical granule, extracellular exosome, extracellular region, lysosomal lumen, membrane
astrocyte cell migration, cellular calcium ion homeostasis, cellular protein metabolic process, chondroitin sulfate catabolic process, ganglioside catabolic process, glycosphingolipid metabolic process, hyaluronan catabolic process, keratan sulfate catabolic process, lipid storage, locomotory behavior, lysosome organization, male courtship behavior, myelination, neuromuscular process controlling balance, neutrophil degranulation, oligosaccharide catabolic process, oogenesis, penetration of zona pellucida, phospholipid biosynthetic process, positive regulation of transcription by RNA polymerase II, regulation of cell shape, sensory perception of sound, single fertilization, skeletal system development
2965147, 2966076 79
43:121
ARAPSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQAK
PSQ00806 FD00012 Procathepsin L
P07711 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
96
collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, fibronectin binding, histone binding, proteoglycan binding, serpin family protein binding
333
Cathepsin L1 , Major excreted protein
CTSL
9606
apical plasma membrane, chromaffin granule, collagen-containing extracellular matrix, endocytic vesicle lumen, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosomal lumen, lysosome, multivesicular body, nucleus, plasma membrane
adaptive immune response, antigen processing and presentation, antigen processing and presentation of exogenous peptide antigen via MHC class II, antigen processing and presentation of peptide antigen, CD4-positive, alpha-beta T cell lineage commitment, cellular response to thyroid hormone stimulus, collagen catabolic process, elastin catabolic process, enkephalin processing, extracellular matrix disassembly, fusion of virus membrane with host endosome membrane, fusion of virus membrane with host plasma membrane, immune response, macrophage apoptotic process, protein autoprocessing, proteolysis, proteolysis involved in cellular protein catabolic process, receptor-mediated endocytosis of virus by host cell, regulation of keratinocyte differentiation, toll-like receptor signaling pathway, viral entry into host cell, zymogen activation
9468501 96
18:113
TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYE
PSQ00809 FD00082 Cathepsin B
P07858 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
62
collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, peptidase activity, proteoglycan binding
339
APP secretase, Cathepsin B1
CTSB
9606
apical plasma membrane, collagen-containing extracellular matrix, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular anatomical structure, lysosome, melanosome, perinuclear region of cytoplasm
cellular response to thyroid hormone stimulus, collagen catabolic process, epithelial cell differentiation, neutrophil degranulation, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of apoptotic process, regulation of catalytic activity, toll-like receptor signaling pathway
3972105 62
18:79
RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLK
PSQ00813 FD00512 Collagen alpha-2(I) chain
P08123 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
57
extracellular matrix structural constituent, extracellular matrix structural constituent conferring tensile strength, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding, protein-macromolecule adaptor activity, SMAD binding
1366
Alpha-2 type I collagen
COL1A2
9606
collagen type I trimer, collagen-containing extracellular matrix, endoplasmic reticulum, endoplasmic reticulum lumen, extracellular exosome, extracellular matrix, extracellular region, extracellular space
blood coagulation, blood vessel development, bone mineralization, cellular response to amino acid stimulus, collagen fibril organization, collagen metabolic process, cytokine-mediated signaling pathway, extracellular matrix assembly, extracellular matrix organization, leukocyte migration, odontogenesis, platelet activation, protein heterotrimerization, regulation of blood pressure, regulation of immune response, Rho protein signal transduction, skeletal system development, skin morphogenesis, transforming growth factor beta receptor signaling pathway
5529814 57
23:79
QSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAA
PSQ00819 FD00118 Alpha-2-antiplasmin
P08697 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
12
endopeptidase inhibitor activity, protease binding, protein homodimerization activity, serine-type endopeptidase inhibitor activity
491
Alpha-2-plasmin inhibitor, Serpin F2
SERPINF2
9606
blood microparticle, cell surface, collagen-containing extracellular matrix, extracellular exosome, extracellular region, extracellular space, fibrinogen complex, platelet alpha granule lumen
acute-phase response, blood vessel morphogenesis, collagen fibril organization, fibrinolysis, maintenance of blood vessel diameter homeostasis by renin-angiotensin, negative regulation of endopeptidase activity, negative regulation of fibrinolysis, negative regulation of plasminogen activation, platelet degranulation, positive regulation of cell differentiation, positive regulation of cell-cell adhesion mediated by cadherin, positive regulation of collagen biosynthetic process, positive regulation of ERK1 and ERK2 cascade, positive regulation of JNK cascade, positive regulation of smooth muscle cell proliferation, positive regulation of stress fiber assembly, positive regulation of transcription by RNA polymerase II, positive regulation of transforming growth factor beta production, response to organic substance
14751930, 16223769, 21075, 2440681 12
28:39
MEPLGRQLTSGP
PSQ00820 FD00017 Coagulation factor VII
P08709 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
40
calcium ion binding, serine-type endopeptidase activity, serine-type peptidase activity, signaling receptor binding
466
Proconvertin, Serum prothrombin conversion accelerator
F7
9606
collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, plasma membrane, serine-type peptidase complex, vesicle
animal organ regeneration, blood coagulation, blood coagulation, extrinsic pathway, circadian rhythm, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of blood coagulation, extrinsic pathway, positive regulation of blood coagulation, positive regulation of cell migration, positive regulation of leukocyte chemotaxis, positive regulation of platelet-derived growth factor receptor signaling pathway, positive regulation of positive chemotaxis, positive regulation of protein kinase B signaling, protein processing, response to 2,3,7,8-tetrachlorodibenzodioxine, response to anticoagulant, response to astaxanthin, response to carbon dioxide, response to cholesterol, response to estradiol, response to estrogen, response to genistein, response to growth hormone, response to hypoxia, response to Thyroid stimulating hormone, response to thyrotropin-releasing hormone, response to thyroxine, response to vitamin K
3264725 40
21:60
AGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRR
PSQ00834 FD00083 Pro-cathepsin H
P09668 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
75
aminopeptidase activity, cysteine-type endopeptidase activator activity involved in apoptotic process, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, HLA-A specific activating MHC class I receptor activity, peptidase activity, serine-type endopeptidase activity, thyroid hormone binding
335
None
CTSH
9606
alveolar lamellar body, collagen-containing extracellular matrix, cytoplasmic ribonucleoprotein granule, cytosol, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular membrane-bounded organelle, lysosome, multivesicular body lumen, secretory granule lumen, tertiary granule lumen
adaptive immune response, antigen processing and presentation, bradykinin catabolic process, cellular protein metabolic process, cellular response to thyroid hormone stimulus, dichotomous subdivision of terminal units involved in lung branching, ERK1 and ERK2 cascade, immune response-regulating signaling pathway, membrane protein proteolysis, metanephros development, negative regulation of apoptotic process, neuropeptide catabolic process, neutrophil degranulation, positive regulation of angiogenesis, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epithelial cell migration, positive regulation of gene expression, positive regulation of peptidase activity, protein destabilization, proteolysis, proteolysis involved in cellular protein catabolic process, response to retinoic acid, surfactant homeostasis, T cell mediated cytotoxicity, zymogen activation
3342889 75
23:97
AELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWS
PSQ00839 FD00226 Furin
P09958 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
81
endopeptidase activity, metal ion binding, nerve growth factor binding, peptidase activity, peptide binding, protease binding, serine-type endopeptidase activity, serine-type endopeptidase inhibitor activity
794
Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme
FURIN
9606
cell surface, endoplasmic reticulum, endosome membrane, extracellular exosome, extracellular region, Golgi lumen, Golgi membrane, integral component of Golgi membrane, membrane, membrane raft, plasma membrane, trans-Golgi network, trans-Golgi network transport vesicle
amyloid fibril formation, blastocyst formation, collagen catabolic process, cornification, dibasic protein processing, extracellular matrix disassembly, extracellular matrix organization, negative regulation of inflammatory response to antigenic stimulus, negative regulation of low-density lipoprotein particle receptor catabolic process, negative regulation of transforming growth factor beta1 production, nerve growth factor processing, nerve growth factor production, peptide biosynthetic process, peptide hormone processing, positive regulation of membrane protein ectodomain proteolysis, positive regulation of transforming growth factor beta1 activation, protein processing, regulation of cholesterol transport, regulation of endopeptidase activity, regulation of lipoprotein lipase activity, regulation of protein catabolic process, regulation of signal transduction, secretion by cell, signal peptide processing, transforming growth factor beta receptor signaling pathway, viral life cycle, viral protein processing, zymogen activation, zymogen inhibition
9130696 81
27:107
QKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKR
PSQ01025 FD00593 Lysosomal alpha-glucosidase
P10253 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
42
alpha-1,4-glucosidase activity, carbohydrate binding, hydrolase activity, hydrolyzing O-glycosyl compounds, maltose alpha-glucosidase activity
959
Acid maltase, Aglucosidase alfa
GAA
9606
azurophil granule membrane, extracellular exosome, ficolin-1-rich granule membrane, intracellular membrane-bounded organelle, lysosomal lumen, lysosomal membrane, lysosome, membrane, plasma membrane, tertiary granule membrane
cardiac muscle contraction, diaphragm contraction, glucose metabolic process, glycogen catabolic process, heart morphogenesis, locomotory behavior, lysosome organization, maltose metabolic process, muscle cell cellular homeostasis, neuromuscular process controlling balance, neuromuscular process controlling posture, neutrophil degranulation, regulation of the force of heart contraction, sucrose metabolic process, tissue development, vacuolar sequestering
3049072 42
28:69
GHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQ
PSQ01036 FD00069 Eosinophil peroxidase
P11678 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
122
heme binding, metal ion binding, peroxidase activity
720
None
EPX
9606
extracellular exosome, extracellular region, extracellular space, secretory granule lumen
defense response to bacterium, defense response to nematode, eosinophil migration, hydrogen peroxide catabolic process, negative regulation of interleukin-10 production, negative regulation of interleukin-5 production, neutrophil degranulation, positive regulation of interleukin-4 production, response to oxidative stress
2541222 122
18:139
QPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAE
PSQ01037 FD00161 Pulmonary surfactant-associated protein C
P11686 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
23
identical protein binding
197
Pulmonary surfactant-associated proteolipid SPL(Val), SP5
SFTPC
9606
alveolar lamellar body, clathrin-coated endocytic vesicle, endoplasmic reticulum membrane, extracellular region, extracellular space, lamellar body, multivesicular body lumen
cellular protein metabolic process, respiratory gaseous exchange by respiratory system
3366248 23
1:23
MDVGSKEVLMESPPDYSAAPRGR
