Details of PSQ00839
| ProSeqID |
PSQ00839 |
| Family |
FD00226 |
| Protein Name |
Furin |
| UniProt ID |
P09958
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
81 |
| Functions |
endopeptidase activity, metal ion binding, nerve growth factor binding, peptidase activity, peptide binding, protease binding, serine-type endopeptidase activity, serine-type endopeptidase inhibitor activity |
| Preproprotein Length (aa) |
794 |
| Alt Name |
Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme |
| Gene Name |
FURIN |
| NCBI ID |
9606 |
| Cellular Localization |
cell surface, endoplasmic reticulum, endosome membrane, extracellular exosome, extracellular region, Golgi lumen, Golgi membrane, integral component of Golgi membrane, membrane, membrane raft, plasma membrane, trans-Golgi network, trans-Golgi network transport vesicle |
| Processes |
amyloid fibril formation, blastocyst formation, collagen catabolic process, cornification, dibasic protein processing, extracellular matrix disassembly, extracellular matrix organization, negative regulation of inflammatory response to antigenic stimulus, negative regulation of low-density lipoprotein particle receptor catabolic process, negative regulation of transforming growth factor beta1 production, nerve growth factor processing, nerve growth factor production, peptide biosynthetic process, peptide hormone processing, positive regulation of membrane protein ectodomain proteolysis, positive regulation of transforming growth factor beta1 activation, protein processing, regulation of cholesterol transport, regulation of endopeptidase activity, regulation of lipoprotein lipase activity, regulation of protein catabolic process, regulation of signal transduction, secretion by cell, signal peptide processing, transforming growth factor beta receptor signaling pathway, viral life cycle, viral protein processing, zymogen activation, zymogen inhibition |
| PubMed |
9130696
|
| Total Prosequence Length (aa) |
81 |
| Prosequence Location |
27:107 |
| Prosequence Sequence |
QKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKR |
| Preproprotein Sequence |
MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL |
