Details of PSQ00809
| ProSeqID |
PSQ00809 |
| Family |
FD00082 |
| Protein Name |
Cathepsin B |
| UniProt ID |
P07858
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
62 |
| Functions |
collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, peptidase activity, proteoglycan binding |
| Preproprotein Length (aa) |
339 |
| Alt Name |
APP secretase, Cathepsin B1 |
| Gene Name |
CTSB |
| NCBI ID |
9606 |
| Cellular Localization |
apical plasma membrane, collagen-containing extracellular matrix, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular anatomical structure, lysosome, melanosome, perinuclear region of cytoplasm |
| Processes |
cellular response to thyroid hormone stimulus, collagen catabolic process, epithelial cell differentiation, neutrophil degranulation, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of apoptotic process, regulation of catalytic activity, toll-like receptor signaling pathway |
| PubMed |
3972105
|
| Total Prosequence Length (aa) |
62 |
| Prosequence Location |
18:79 |
| Prosequence Sequence |
RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLK |
| Preproprotein Sequence |
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |