Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00809

ProSeqID PSQ00809
Family FD00082
Protein Name Cathepsin B
UniProt ID P07858
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 62
Functions collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, peptidase activity, proteoglycan binding
Preproprotein Length (aa) 339
Alt Name APP secretase, Cathepsin B1
Gene Name CTSB
NCBI ID 9606
Cellular Localization apical plasma membrane, collagen-containing extracellular matrix, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular anatomical structure, lysosome, melanosome, perinuclear region of cytoplasm
Processes cellular response to thyroid hormone stimulus, collagen catabolic process, epithelial cell differentiation, neutrophil degranulation, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of apoptotic process, regulation of catalytic activity, toll-like receptor signaling pathway
PubMed 3972105
Total Prosequence Length (aa) 62
Prosequence Location 18:79
Prosequence Sequence RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLK
Preproprotein Sequence MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI