Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00794

ProSeqID PSQ00794
Family FD00004
Protein Name Prostate-specific antigen
UniProt ID P07288
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 7
Functions endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity, serine-type peptidase activity
Preproprotein Length (aa) 261
Alt Name Gamma-seminoprotein, Kallikrein-3, P-30 antigen, Semenogelase
Gene Name KLK3
NCBI ID 9606
Cellular Localization extracellular exosome, extracellular region, extracellular space, nucleus, protein-containing complex, secretory granule
Processes cellular protein metabolic process, negative regulation of angiogenesis, positive regulation of antibacterial peptide production, proteolysis, regulation of androgen receptor signaling pathway, regulation of systemic arterial blood pressure, zymogen activation
PubMed 2422647, 3691515
Total Prosequence Length (aa) 7
Prosequence Location 18:24
Prosequence Sequence APLILSR
Preproprotein Sequence MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP