Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00784

ProSeqID PSQ00784
Family FD00052
Protein Name Corticoliberin
UniProt ID P06850
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 129
Functions corticotropin-releasing hormone activity, corticotropin-releasing hormone receptor 1 binding, corticotropin-releasing hormone receptor 2 binding, hormone activity, neuropeptide hormone activity, signaling receptor binding
Preproprotein Length (aa) 196
Alt Name Corticotropin-releasing factor, Corticotropin-releasing hormone
Gene Name CRH
NCBI ID 9606
Cellular Localization cytoplasm, extracellular region, extracellular space, perikaryon, synapse, varicosity
Processes associative learning, cellular response to cocaine, cellular response to dexamethasone stimulus, chemical synaptic transmission, diterpenoid metabolic process, female pregnancy, G protein-coupled receptor signaling pathway, hormone-mediated apoptotic signaling pathway, hypothalamus development, inflammatory response, ion homeostasis, learning or memory, long-term synaptic potentiation, negative regulation of cell death, negative regulation of circadian sleep/wake cycle, REM sleep, negative regulation of epinephrine secretion, negative regulation of gene expression, negative regulation of glucagon secretion, negative regulation of inflammatory response to antigenic stimulus, negative regulation of luteinizing hormone secretion, negative regulation of norepinephrine secretion, negative regulation of systemic arterial blood pressure, parturition, positive regulation of behavioral fear response, positive regulation of calcium ion import, positive regulation of cAMP-mediated signaling, positive regulation of cell death, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, wakefulness, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of digestive system process, positive regulation of gene expression, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of protein phosphorylation, regulation of NMDA receptor activity, regulation of serotonin secretion, response to corticosterone, response to drug, response to estrogen, response to ethanol, response to ether, response to immobilization stress, response to pain, signal transduction, steroid metabolic process, synaptic transmission, dopaminergic
PubMed 3262120
Total Prosequence Length (aa) 129
Prosequence Location 25:153
Prosequence Sequence LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERR
Preproprotein Sequence MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK