Details of PSQ00732
| ProSeqID |
PSQ00732 |
| Family |
FD00042 |
| Protein Name |
Osteocalcin |
| UniProt ID |
P02818
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
28 |
| Functions |
calcium ion binding, hydroxyapatite binding, structural constituent of bone, structural molecule activity |
| Preproprotein Length (aa) |
100 |
| Alt Name |
Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Gene Name |
BGLAP |
| NCBI ID |
9606 |
| Cellular Localization |
cytoplasm, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, perikaryon, rough endoplasmic reticulum, vesicle |
| Processes |
bone development, bone mineralization, cell adhesion, cell aging, cellular response to growth factor stimulus, cellular response to vitamin D, endoplasmic reticulum to Golgi vesicle-mediated transport, odontogenesis, osteoblast development, osteoblast differentiation, regulation of bone mineralization, regulation of bone resorption, regulation of cellular response to insulin stimulus, regulation of osteoclast differentiation, response to activity, response to drug, response to estrogen, response to ethanol, response to glucocorticoid, response to gravity, response to hydroxyisoflavone, response to mechanical stimulus, response to testosterone, response to vitamin D, response to vitamin K, response to zinc ion, skeletal system development |
| PubMed |
6967872
|
| Total Prosequence Length (aa) |
28 |
| Prosequence Location |
24:51 |
| Prosequence Sequence |
KPSGAESSKGAAFVSKQEGSEVVKRPRR |
| Preproprotein Sequence |
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
