PSQ01048 FD00437 Gamma-interferon-inducible lysosomal thiol reductase
P13284 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
31, 18
oxidoreductase activity, oxidoreductase activity, acting on a sulfur group of donors
250
Gamma-interferon-inducible protein IP-30, Legumaturain
IFI30
9606
cell junction, cytosol, extracellular region, intracellular membrane-bounded organelle, lysosomal lumen, lysosome
antigen processing and presentation of exogenous peptide antigen via MHC class I, antigen processing and presentation of exogenous peptide antigen via MHC class II, interferon-gamma-mediated signaling pathway, negative regulation of fibroblast proliferation, protein stabilization
10639150;10639150 49
27:57, 233:250
SPLQALDFFGNGPPVNYKTGNLYLRGPLKKS, KPDVCPSSTSSLRSVCFK
PSQ01050 FD00185 Bone morphogenetic protein 1
P13497 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
98
calcium ion binding, cytokine activity, growth factor activity, identical protein binding, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, zinc ion binding
986
Mammalian tolloid protein, Procollagen C-proteinase
BMP1
9606
extracellular region, extracellular space, Golgi apparatus, vesicle
cartilage condensation, cell differentiation, collagen fibril organization, extracellular matrix disassembly, high-density lipoprotein particle assembly, multicellular organism development, ossification, positive regulation of cartilage development, proteolysis, skeletal system development
12637569 98
23:120
LDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
PSQ01051 FD00328 Oncostatin-M
P13725 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
31
cytokine activity, growth factor activity, oncostatin-M receptor binding
252
None
OSM
9606
extracellular region, extracellular space
cytokine-mediated signaling pathway, immune response, multicellular organism development, negative regulation of cell population proliferation, negative regulation of hormone secretion, oncostatin-M-mediated signaling pathway, positive regulation of acute inflammatory response, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of inflammatory response, positive regulation of interleukin-17 production, positive regulation of MAPK cascade, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of protein kinase B signaling, positive regulation of transcription by RNA polymerase II, positive regulation of tyrosine phosphorylation of STAT protein, regulation of growth, regulation of hematopoietic stem cell differentiation
2325640 31
222:252
HSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
PSQ01052 FD00148 Bone marrow proteoglycan
P13727 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
89
carbohydrate binding, extracellular matrix structural constituent conferring compression resistance, heparin binding
222
Proteoglycan 2
PRG2
9606
collagen-containing extracellular matrix, extracellular exosome, extracellular region, ficolin-1-rich granule lumen, transport vesicle
defense response to bacterium, neutrophil degranulation
2501794, 3410852 89
17:105
LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQ
PSQ01054 FD00547 CD59 glycoprotein
P13987 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
26
complement binding
128
1F5 antigen, 20 kDa homologous restriction factor, MAC-inhibitory protein, MEM43 antigen, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, Protectin
CD59
9606
anchored component of external side of plasma membrane, cell surface, endoplasmic reticulum membrane, endoplasmic reticulum-Golgi intermediate compartment membrane, ER to Golgi transport vesicle membrane, extracellular exosome, extracellular space, focal adhesion, Golgi membrane, membrane, plasma membrane, specific granule membrane, tertiary granule membrane, transport vesicle, vesicle
blood coagulation, cell surface receptor signaling pathway, COPII vesicle coating, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of activation of membrane attack complex, neutrophil degranulation, regulation of complement activation, regulation of complement-dependent cytotoxicity
9054419 26
103:128
GGTSLSEKTVLLLVTPFLAAAWSLHP
PSQ01056 FD00204 Cathepsin E
P14091 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
34
aspartic-type endopeptidase activity, identical protein binding, peptidase activity
396
None
CTSE
9606
endosome
antigen processing and presentation of exogenous peptide antigen via MHC class II, protein autoprocessing, proteolysis
2334440, 8346912 34
20:53
SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDM
PSQ01064 FD00205 Mast cell carboxypeptidase A
P15088 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
94
metallocarboxypeptidase activity, zinc ion binding
420
Carboxypeptidase A3
CPA3
9606
collagen-containing extracellular matrix, extracellular region, extracellular space, secretory granule, transport vesicle
angiotensin maturation, proteolysis
2708524 94
16:109
IAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKED
PSQ01084 FD00394 Dipeptidase 1
P16444 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
26
beta-lactamase activity, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, GPI anchor binding, metallodipeptidase activity, metalloexopeptidase activity, modified amino acid binding, zinc ion binding
418
Beta-lactamase , Dehydropeptidase-I, Microsomal dipeptidase , Renal dipeptidase
DPEP1
9606
anchored component of membrane, apical part of cell, apical plasma membrane, cell junction, extracellular exosome, extracellular space, microvillus membrane, nucleoplasm, plasma membrane
aflatoxin metabolic process, antibiotic metabolic process, cellular lactam catabolic process, cellular response to calcium ion, cellular response to drug, cellular response to nitric oxide, glutathione catabolic process, glutathione metabolic process, homocysteine metabolic process, inflammatory response, leukotriene metabolic process, lipid metabolic process, negative regulation of apoptotic process, negative regulation of cell migration, negative regulation of cysteine-type endopeptidase activity involved in apoptotic process, negative regulation of inflammatory response to antigenic stimulus, neutrophil chemotaxis
2168407 26
386:411
GASSLHRHWGLLLASLAPLVLCLSLL
PSQ01094 FD00339 Ganglioside GM2 activator
P17900 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
8
beta-N-acetylgalactosaminidase activity, lipid transporter activity, phospholipase activator activity
193
Cerebroside sulfate activator protein, GM2-AP, Sphingolipid activator protein 3
GM2A
9606
apical plasma membrane, azurophil granule lumen, basolateral plasma membrane, cytoplasmic side of plasma membrane, cytosol, extracellular exosome, extracellular region, intracellular membrane-bounded organelle, lysosomal lumen
ganglioside catabolic process, glycosphingolipid metabolic process, learning or memory, lipid storage, lipid transport, neuromuscular process controlling balance, neutrophil degranulation, oligosaccharide catabolic process, positive regulation of hydrolase activity
2209618 8
24:31
HLKKPSQL
PSQ01096 FD00535 Bone morphogenetic protein 7
P18075 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
263
BMP receptor binding, cytokine activity, growth factor activity, heparin binding
431
Osteogenic protein 1
BMP7
9606
collagen-containing extracellular matrix, extracellular region, extracellular space, vesicle
allantois development, axon guidance, BMP signaling pathway, branching involved in salivary gland morphogenesis, branching morphogenesis of an epithelial tube, cardiac muscle tissue development, cardiac septum morphogenesis, cartilage development, cellular response to BMP stimulus, cellular response to hypoxia, chorio-allantoic fusion, dendrite development, embryonic camera-type eye morphogenesis, embryonic limb morphogenesis, embryonic pattern specification, embryonic skeletal joint morphogenesis, endocardial cushion formation, epithelial cell differentiation, epithelial to mesenchymal transition, heart trabecula morphogenesis, hindbrain development, mesenchymal cell differentiation, mesenchyme development, mesoderm formation, mesonephros development, metanephric mesenchymal cell proliferation involved in metanephros development, metanephric mesenchyme morphogenesis, metanephros development, monocyte aggregation, negative regulation of cell cycle, negative regulation of cell death, negative regulation of glomerular mesangial cell proliferation, negative regulation of MAP kinase activity, negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis, negative regulation of mitotic nuclear division, negative regulation of neurogenesis, negative regulation of neuron differentiation, negative regulation of NF-kappaB transcription factor activity, negative regulation of NIK/NF-kappaB signaling, negative regulation of Notch signaling pathway, negative regulation of phosphorylation, negative regulation of prostatic bud formation, negative regulation of striated muscle cell apoptotic process, negative regulation of transcription, DNA-templated, nephrogenic mesenchyme morphogenesis, neural fold elevation formation, neuron projection morphogenesis, odontogenesis of dentin-containing tooth, ossification, pericardium morphogenesis, pharyngeal system development, positive regulation of apoptotic process, positive regulation of bone mineralization, positive regulation of brown fat cell differentiation, positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis, positive regulation of dendrite development, positive regulation of epithelial to mesenchymal transition, positive regulation of gene expression, positive regulation of heterotypic cell-cell adhesion, positive regulation of hyaluranon cable assembly, positive regulation of neuron differentiation, positive regulation of osteoblast differentiation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, protein localization to nucleus, regulation of branching involved in prostate gland morphogenesis, regulation of pathway-restricted SMAD protein phosphorylation, regulation of removal of superoxide radicals, response to estradiol, response to peptide hormone, response to vitamin D, skeletal system development, SMAD protein signal transduction, steroid hormone mediated signaling pathway, ureteric bud development
17977014 263
30:292
DFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIR
PSQ01111 FD00323 Inter-alpha-trypsin inhibitor heavy chain H1
P19827 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
7
calcium ion binding, serine-type endopeptidase inhibitor activity
911
Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein
ITIH1
9606
blood microparticle, collagen-containing extracellular matrix, extracellular exosome, extracellular region
hyaluronan metabolic process
2476436 7
28:34
LGSATGR
PSQ01112 FD00184 Elafin
P19957 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
38
endopeptidase inhibitor activity, serine-type endopeptidase inhibitor activity, structural constituent of skin epidermis
120
Elastase-specific inhibitor, Peptidase inhibitor 3, Protease inhibitor WAP3, Skin-derived antileukoproteinase, WAP four-disulfide core domain protein 14
PI3
9606
cornified envelope, cytosol, extracellular matrix, extracellular region, extracellular space
antibacterial humoral response, antimicrobial humoral response, copulation, cornification, innate immune response, peptide cross-linking
1536690, 2394696 38
23:60
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
PSQ01113 FD00004 Azurocidin
P20160 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
7
heparan sulfate proteoglycan binding, heparin binding, peptidase activity, serine-type endopeptidase activity, toxic substance binding
251
Cationic antimicrobial protein CAP37 , Heparin-binding protein
AZU1
9606
azurophil granule, azurophil granule lumen, azurophil granule membrane, extracellular exosome, extracellular region, extracellular space, extrinsic component of membrane, intracellular membrane-bounded organelle
antimicrobial humoral response, calcium-mediated signaling using intracellular calcium source, cell chemotaxis, cellular extravasation, defense response to Gram-negative bacterium, defense response to virus, glial cell migration, induction of positive chemotaxis, inflammatory response, macrophage chemotaxis, microglial cell activation, monocyte activation, negative regulation of apoptotic process, neutrophil degranulation, neutrophil-mediated killing of bacterium, positive regulation of cell adhesion, positive regulation of fractalkine production, positive regulation of gene expression, positive regulation of interleukin-1 beta production, positive regulation of MHC class II biosynthetic process, positive regulation of peptidyl-threonine phosphorylation, positive regulation of phagocytosis, positive regulation of protein kinase activity, positive regulation of tumor necrosis factor production, protein kinase C signaling, protein kinase C-activating G protein-coupled receptor signaling pathway, proteolysis, regulation of vascular permeability
10534120, 1399008, 1897955, 1937776, 2026172, 2226832, 2332502, 2404977, 2406527, 2501794 7
20:26
GSSPLLD
PSQ01118 FD00170 Proteasome subunit beta type-1
P20618 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
28
endopeptidase activity, threonine-type endopeptidase activity
241
Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome component C5, Proteasome gamma chain
PSMB1
9606
cytoplasm, cytosol, extracellular exosome, extracellular region, ficolin-1-rich granule lumen, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex, secretory granule lumen
anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, neutrophil degranulation, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway
2306472 28
1:28
MLSSTAMYSAPGRDLGMEPHRAAGPLQL
PSQ01130 FD00172 Biglycan
P21810 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
21
extracellular matrix binding, extracellular matrix structural constituent, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding
368
Bone, PG-S1
BGN
9606
cell surface, collagen-containing extracellular matrix, extracellular exosome, extracellular matrix, extracellular region, extracellular space, Golgi lumen, lysosomal lumen, sarcolemma, transport vesicle
articular cartilage development, blood vessel remodeling, bone development, chondroitin sulfate biosynthetic process, chondroitin sulfate catabolic process, dermatan sulfate biosynthetic process, extracellular matrix organization, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
2590169, 3597437 21
17:37
LPFEQRGFWDFTLDDGPFMMN
PSQ01135 FD00069 Lactoperoxidase
P22079 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
54
heme binding, metal ion binding, peroxidase activity, thiocyanate peroxidase activity
719
Salivary peroxidase
LPO
9606
basolateral plasma membrane, cytoplasm, extracellular exosome, extracellular region, extracellular space
cell redox homeostasis, defense response to bacterium, detection of chemical stimulus involved in sensory perception of bitter taste, hydrogen peroxide catabolic process, response to oxidative stress
10715594 54
27:80
QTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQLSEYLKHAKGR
PSQ01137 FD00392 Iduronate 2-sulfatase
P22304 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
8
calcium ion binding, iduronate-2-sulfatase activity, sulfuric ester hydrolase activity
550
Alpha-L-iduronate sulfate sulfatase
IDS
9606
lysosomal lumen, lysosome
chondroitin sulfate catabolic process, glycosaminoglycan catabolic process
2122463 8
26:33
SETQANST
PSQ01153 FD00125 Brain-derived neurotrophic factor
P23560 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
110
growth factor activity, nerve growth factor receptor binding
247
Abrineurin
BDNF
9606
axon, cytoplasm, dendrite, extracellular region, extracellular space, mitochondrion, nuclear speck, perinuclear region of cytoplasm, synaptic vesicle
activation of phospholipase C activity, axon guidance, brain-derived neurotrophic factor receptor signaling pathway, collateral sprouting, memory, modulation of chemical synaptic transmission, negative regulation of apoptotic signaling pathway, negative regulation of myotube differentiation, negative regulation of neuron apoptotic process, nerve development, nerve growth factor signaling pathway, nervous system development, neuron projection morphogenesis, neurotrophin TRK receptor signaling pathway, peripheral nervous system development, positive regulation of brain-derived neurotrophic factor receptor signaling pathway, positive regulation of collateral sprouting, positive regulation of neuron projection development, positive regulation of non-membrane spanning protein tyrosine kinase activity, positive regulation of peptidyl-serine phosphorylation, positive regulation of receptor binding, positive regulation of synapse assembly, regulation of neuron differentiation, regulation of protein localization to cell surface, synapse assembly, transmembrane receptor protein tyrosine kinase signaling pathway
8527932 110
19:128
APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR
PSQ01174 FD00494 Acyloxyacyl hydrolase
P28039 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
11
acyloxyacyl hydrolase activity, calcium ion binding
575
None
AOAH
9606
cytoplasmic vesicle, extracellular region, intracellular membrane-bounded organelle
fatty acid metabolic process, lipopolysaccharide catabolic process, negative regulation of inflammatory response
1883828 11
24:34
SPANDDQSRPS
PSQ01176 FD00142 Proteasome subunit beta type-4
P28070 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo
Homo sapiens (Human)
45
endopeptidase activity, lipopolysaccharide binding, threonine-type endopeptidase activity
264
26 kDa prosomal protein, Macropain beta chain, Multicatalytic endopeptidase complex beta chain, Proteasome beta chain, Proteasome chain 3
PSMB4
9606
ciliary basal body, cytoplasm, cytosol, extracellular exosome, mitochondrion, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex
anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, negative regulation of inflammatory response to antigenic stimulus, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway
2306472 45
1:45
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITR
