Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | PreProtein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ00595 | FD00425 | Agouti-related protein | O00253 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 62 | melanocortin receptor binding, neuropeptide hormone activity, signaling receptor binding, type 1 melanocortin receptor binding | 132 | None | AGRP | 9606 | extracellular space, Golgi lumen, neuronal cell body | adult feeding behavior, circadian rhythm, eating behavior, feeding behavior, hormone-mediated signaling pathway, long-day photoperiodism, maternal process involved in female pregnancy, neuropeptide signaling pathway, positive regulation of feeding behavior, regulation of feeding behavior, response to insulin | 16384863, 17185225 | 62 | 21:82 | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR | |
PSQ00603 | FD00087 | Tripeptidyl-peptidase 1 | O14773 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 176 | endopeptidase activity, lysophosphatidic acid binding, metal ion binding, peptidase activity, peptide binding, serine-type endopeptidase activity, serine-type peptidase activity, sulfatide binding, tripeptidyl-peptidase activity | 563 | Cell growth-inhibiting gene 1 protein, Lysosomal pepstatin-insensitive protease, Tripeptidyl aminopeptidase, Tripeptidyl-peptidase I | TPP1 | 9606 | extracellular exosome, Golgi apparatus, lysosomal lumen, lysosome, melanosome, membrane raft, recycling endosome | bone resorption, central nervous system development, epithelial cell differentiation, IRE1-mediated unfolded protein response, lipid metabolic process, lysosomal protein catabolic process, lysosome organization, nervous system development, neuromuscular process controlling balance, peptide catabolic process, protein catabolic process, protein localization to chromosome, telomeric region, proteolysis | 11054422, 25944712 | 176 | 20:195 | SYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVG | |
PSQ00614 | FD00189 | Serine protease HTRA2 | O43464 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 102 | identical protein binding, peptidase activity, serine-type endopeptidase activity, serine-type peptidase activity, unfolded protein binding | 458 | High temperature requirement protein A2, Omi stress-regulated endoprotease, Serine protease 25, Serine proteinase OMI | HTRA2 | 9606 | CD40 receptor complex, chromatin, cytoplasmic side of plasma membrane, cytoskeleton, cytosol, endoplasmic reticulum, endoplasmic reticulum membrane, membrane, mitochondrial intermembrane space, mitochondrial membrane, mitochondrion, nucleus, serine-type endopeptidase complex | adult walking behavior, aging, cellular protein catabolic process, cellular response to growth factor stimulus, cellular response to heat, cellular response to interferon-beta, cellular response to oxidative stress, cellular response to retinoic acid, ceramide metabolic process, execution phase of apoptosis, forebrain development, intrinsic apoptotic signaling pathway in response to DNA damage, mitochondrion organization, negative regulation of cell cycle, negative regulation of mitophagy in response to mitochondrial depolarization, negative regulation of neuron death, negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway, neuron development, pentacyclic triterpenoid metabolic process, positive regulation of apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of mitochondrion organization, positive regulation of protein targeting to mitochondrion, programmed cell death, protein autoprocessing, proteolysis, regulation of autophagy of mitochondrion, regulation of multicellular organism growth, response to herbicide | 11583623 | 102 | 32:133 | TPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLA | |
PSQ00615 | FD00244 | Peptidase inhibitor 15 | O43692 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 41 | peptidase inhibitor activity | 258 | 25 kDa trypsin inhibitor, Cysteine-rich secretory protein 8, SugarCrisp | PI15 | 9606 | extracellular exosome, extracellular space | multicellular organism development | 8882727 | 41 | 20:60 | STVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR | |
PSQ00616 | FD00129 | Vascular endothelial growth factor D | O43915 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 67 | chemoattractant activity, growth factor activity, identical protein binding, platelet-derived growth factor receptor binding, vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor binding | 360 | c-Fos-induced growth factor | VEGFD | 9606 | extracellular region, extracellular space, membrane, platelet alpha granule lumen | cell population proliferation, dopaminergic neuron differentiation, induction of positive chemotaxis, platelet degranulation, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of endothelial cell proliferation, positive regulation of mast cell chemotaxis, positive regulation of protein phosphorylation, response to bacterium, response to hypoxia, sprouting angiogenesis, vascular endothelial growth factor receptor signaling pathway, vascular endothelial growth factor signaling pathway | 10542248 | 67 | 22:88 | SSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFTSMDSRSASHRSTR | |
PSQ00624 | FD00396 | Cubilin | O60494 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 12 | calcium ion binding, cargo receptor activity, cobalamin binding, protein homodimerization activity, signaling receptor activity | 3623 | 460 kDa receptor, Intestinal intrinsic factor receptor, Intrinsic factor-cobalamin receptor, Intrinsic factor-vitamin B12 receptor | CUBN | 9606 | apical plasma membrane, brush border membrane, clathrin-coated pit, cytosol, endocytic vesicle, endoplasmic reticulum, endosome membrane, extracellular exosome, extrinsic component of external side of plasma membrane, Golgi apparatus, lysosomal lumen, lysosomal membrane, membrane, plasma membrane, receptor complex | cholesterol metabolic process, cobalamin metabolic process, cobalamin transport, high-density lipoprotein particle clearance, lipoprotein transport, receptor-mediated endocytosis, response to bacterium, tissue homeostasis, vitamin D metabolic process | 9572993 | 12 | 24:35 | EAGELELQRQKR | |
PSQ00631 | FD00531 | Attractin | O75882 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 55 | carbohydrate binding, signaling receptor activity | 1429 | DPPT-L, Mahogany homolog | ATRN | 9606 | basement membrane, cytoplasm, extracellular exosome, extracellular space, integral component of plasma membrane, plasma membrane | animal organ morphogenesis, cell migration, cerebellum development, inflammatory response, myelination, pigmentation, regulation of multicellular organism growth, response to oxidative stress, substrate adhesion-dependent cell spreading, tissue development | 17261078 | 55 | 29:83 | PHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPRLLLLLLLLSPPLLLLLLPCEAEA | |
PSQ00651 | FD00298 | Interleukin-33 | O95760 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 94 | cytokine activity, interleukin-33 receptor binding | 270 | Interleukin-1 family member 11, Nuclear factor from high endothelial venules | IL33 | 9606 | chromosome, cytoplasm, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm, nucleus, transport vesicle | defense response to virus, extrinsic apoptotic signaling pathway, interleukin-33-mediated signaling pathway, microglial cell activation involved in immune response, microglial cell proliferation, negative regulation of immunoglobulin production, negative regulation of interferon-gamma production, negative regulation of leukocyte migration, negative regulation of macrophage proliferation, negative regulation of T-helper 1 type immune response, negative regulation of transcription by RNA polymerase II, positive regulation of CD80 production, positive regulation of CD86 production, positive regulation of cellular defense response, positive regulation of chemokine production, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immunoglobulin production, positive regulation of inflammatory response, positive regulation of interleukin-13 production, positive regulation of interleukin-4 production, positive regulation of interleukin-5 production, positive regulation of interleukin-6 production, positive regulation of macrophage activation, positive regulation of MHC class I biosynthetic process, positive regulation of MHC class II biosynthetic process, positive regulation of neuroinflammatory response, positive regulation of nitric-oxide synthase biosynthetic process, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of type 2 immune response, protein deubiquitination | 22307629 | 94 | 1:94 | MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECF | |
PSQ00652 | FD00534 | Apoptosis-inducing factor 1 | O95831 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 47 | DNA binding, FAD binding, NAD(P)H oxidase H2O2-forming activity, NADH dehydrogenase activity, oxidoreductase activity, acting on NAD(P)H, protein dimerization activity | 613 | Programmed cell death protein 8 | AIFM1 | 9606 | cytosol, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrion, nucleus, perinuclear region of cytoplasm | activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, chromosome condensation, intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress, mitochondrial respiratory chain complex assembly, mitochondrial respiratory chain complex I assembly, neuron differentiation, positive regulation of apoptotic process, protein import into mitochondrial intermembrane space | 16365034 | 47 | 55:101 | ASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISG | |
PSQ00675 | FD00348 | Prothrombin | P00734 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 19 | calcium ion binding, enzyme activator activity, growth factor activity, heparin binding, lipopolysaccharide binding, serine-type endopeptidase activity, signaling receptor binding, thrombospondin receptor activity | 622 | Coagulation factor II | F2 | 9606 | blood microparticle, collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, Golgi lumen, plasma membrane | acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, blood coagulation, blood coagulation, intrinsic pathway, cell surface receptor signaling pathway, cellular protein metabolic process, cytolysis by host of symbiont cells, endoplasmic reticulum to Golgi vesicle-mediated transport, fibrinolysis, G protein-coupled receptor signaling pathway, leukocyte migration, multicellular organism development, negative regulation of astrocyte differentiation, negative regulation of cytokine production involved in inflammatory response, negative regulation of fibrinolysis, negative regulation of platelet activation, negative regulation of proteolysis, neutrophil-mediated killing of gram-negative bacterium, platelet activation, positive regulation of blood coagulation, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of collagen biosynthetic process, positive regulation of lipid kinase activity, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway, positive regulation of protein localization to nucleus, positive regulation of protein phosphorylation, positive regulation of reactive oxygen species metabolic process, positive regulation of receptor signaling pathway via JAK-STAT, positive regulation of release of sequestered calcium ion into cytosol, proteolysis, regulation of blood coagulation, regulation of cell shape, regulation of complement activation, regulation of cytosolic calcium ion concentration, response to wounding | 266717, 8073540 | 19 | 25:43 | QHVFLAPQQARSLLQRVRR | |
PSQ00676 | FD00017 | Coagulation factor IX | P00740 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 18 | calcium ion binding, endopeptidase activity, serine-type endopeptidase activity | 461 | Christmas factor, Plasma thromboplastin component | F9 | 9606 | collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, Golgi lumen, plasma membrane | blood coagulation, blood coagulation, intrinsic pathway, endoplasmic reticulum to Golgi vesicle-mediated transport, proteolysis, zymogen activation | 2592373 | 18 | 29:46 | TVFLDHENANKILNRPKR | |
PSQ00677 | FD00017 | Coagulation factor X | P00742 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 9 | calcium ion binding, phospholipid binding, serine-type endopeptidase activity | 488 | Stuart factor, Stuart-Prower factor | F10 | 9606 | endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, intrinsic component of external side of plasma membrane, plasma membrane | blood coagulation, blood coagulation, extrinsic pathway, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of blood coagulation, extrinsic pathway, positive regulation of cell migration, positive regulation of protein kinase B signaling | 6871167 | 9 | 32:40 | NNILARVTR | |
PSQ00680 | FD00300 | Tissue-type plasminogen activator | P00750 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 10 | phosphoprotein binding, serine-type endopeptidase activity, signaling receptor binding | 562 | None | PLAT | 9606 | cell surface, cytoplasm, extracellular exosome, extracellular region, extracellular space | blood coagulation, cellular protein modification process, fibrinolysis, negative regulation of proteolysis, plasminogen activation, platelet-derived growth factor receptor signaling pathway, prevention of polyspermy, proteolysis, smooth muscle cell migration | 6682760 | 10 | 23:32 | SQEIHARFRR | |
PSQ00697 | FD00099 | Renin | P00797 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 43 | aspartic-type endopeptidase activity, insulin-like growth factor receptor binding, peptidase activity, signaling receptor binding | 406 | Angiotensinogenase | REN | 9606 | apical part of cell, cytoplasm, extracellular region, extracellular space, plasma membrane | amyloid-beta metabolic process, angiotensin maturation, cell maturation, cellular response to drug, drinking behavior, hormone-mediated signaling pathway, kidney development, male gonad development, mesonephros development, proteolysis, regulation of blood pressure, regulation of MAPK cascade, renin-angiotensin regulation of aldosterone production, response to cAMP, response to cGMP, response to immobilization stress, response to lipopolysaccharide | 2016271 | 43 | 24:66 | LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKR | |
PSQ00711 | FD00165 | Parathyroid hormone | P01270 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 6 | hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, receptor ligand activity, type 1 parathyroid hormone receptor binding | 120 | Parathormone, Parathyrin | PTH | 9606 | extracellular region, extracellular space | activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, bone resorption, cAMP metabolic process, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, G protein-coupled receptor signaling pathway, homeostasis of number of cells within a tissue, hormone-mediated apoptotic signaling pathway, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of bone mineralization involved in bone maturation, negative regulation of chondrocyte differentiation, negative regulation of gene expression, negative regulation of inflammatory response to antigenic stimulus, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II, regulation of gene expression, response to cadmium ion, response to drug, response to ethanol, response to fibroblast growth factor, response to lead ion, response to parathyroid hormone, response to vitamin D, Rho protein signal transduction, skeletal system development | 4521809 | 6 | 26:31 | KSVKKR | |
PSQ00712 | FD00432 | Pro-glucagon | P01275 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 6 | glucagon receptor binding, hormone activity, identical protein binding, signaling receptor binding | 180 | None | GCG | 9606 | endoplasmic reticulum lumen, extracellular region, extracellular space, secretory granule lumen | adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to glucagon stimulus, feeding behavior, G protein-coupled receptor signaling pathway, glucose homeostasis, negative regulation of apoptotic process, negative regulation of execution phase of apoptosis, negative regulation of inflammatory response to antigenic stimulus, positive regulation of calcium ion import, positive regulation of ERK1 and ERK2 cascade, positive regulation of gluconeogenesis, positive regulation of histone H3-K4 methylation, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of protein binding, positive regulation of protein kinase activity, protein kinase A signaling, regulation of insulin secretion, response to activity | 2753890 | 6 | 84:89 | NRNNIA | |
PSQ00713 | FD00096 | Somatoliberin | P01286 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 11 | growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding | 108 | Growth hormone-releasing factor, Growth hormone-releasing hormone, Somatocrinin, Somatorelin | GHRH | 9606 | extracellular region, extracellular space, perikaryon, terminal bouton | adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, G protein-coupled receptor signaling pathway, growth hormone secretion, negative regulation of inflammatory response to antigenic stimulus, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, REM sleep, positive regulation of growth hormone secretion, positive regulation of insulin-like growth factor receptor signaling pathway, positive regulation of multicellular organism growth, response to food | 6812220 | 11 | 21:31 | PPPPLTLRMRR | |
PSQ00722 | FD00092 | Interleukin-1 alpha | P01583 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 112 | copper ion binding, cytokine activity, interleukin-1 receptor binding | 271 | Hematopoietin-1 | IL1A | 9606 | cytosol, extracellular region, extracellular space | apoptotic process, cellular response to heat, cellular response to lipopolysaccharide, cellular sodium ion homeostasis, connective tissue replacement involved in inflammatory response wound healing, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, immune response, inflammatory response, interleukin-1-mediated signaling pathway, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of vascular endothelial growth factor production, regulation of nitric-oxide synthase activity, response to copper ion | 3281727 | 112 | 1:112 | MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPR | |
PSQ00723 | FD00092 | Interleukin-1 beta | P01584 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 116 | cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding | 269 | Catabolin | IL1B | 9606 | cytosol, extracellular region, extracellular space, lysosome | activation of MAPK activity, apoptotic process, cell-cell signaling, cellular response to drug, cellular response to lipopolysaccharide, cellular response to mechanical stimulus, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, embryo implantation, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, lipopolysaccharide-mediated signaling pathway, MAPK cascade, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of glucose transmembrane transport, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neurogenesis, negative regulation of synaptic transmission, positive regulation of angiogenesis, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell adhesion molecule production, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of complement activation, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of histone acetylation, positive regulation of histone phosphorylation, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuroinflammatory response, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein export from nucleus, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of T cell mediated immunity, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, positive regulation of vascular endothelial growth factor receptor signaling pathway, protein kinase B signaling, purinergic nucleotide receptor signaling pathway, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, signal transduction, smooth muscle adaptation, vascular endothelial growth factor production | 3281727, 3920526 | 116 | 1:116 | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHD | |
PSQ00724 | FD00127 | Collagen alpha-1(I) chain | P02452 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 139 | extracellular matrix structural constituent, extracellular matrix structural constituent conferring tensile strength, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding | 1464 | Alpha-1 type I collagen | COL1A1 | 9606 | collagen type I trimer, collagen-containing extracellular matrix, cytoplasm, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, secretory granule | blood coagulation, blood vessel development, bone trabecula formation, cartilage development involved in endochondral bone morphogenesis, cellular response to amino acid stimulus, cellular response to epidermal growth factor stimulus, cellular response to fibroblast growth factor stimulus, cellular response to fluoride, cellular response to mechanical stimulus, cellular response to retinoic acid, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, cellular response to vitamin E, collagen biosynthetic process, collagen fibril organization, collagen-activated tyrosine kinase receptor signaling pathway, embryonic skeletal system development, endochondral ossification, extracellular matrix organization, face morphogenesis, intramembranous ossification, leukocyte migration, negative regulation of cell-substrate adhesion, ossification, osteoblast differentiation, platelet activation, positive regulation of canonical Wnt signaling pathway, positive regulation of cell migration, positive regulation of epithelial to mesenchymal transition, positive regulation of transcription, DNA-templated, protein localization to nucleus, protein transport, regulation of immune response, response to cAMP, response to corticosteroid, response to drug, response to estradiol, response to hydrogen peroxide, response to hyperoxia, response to mechanical stimulus, response to peptide hormone, sensory perception of sound, skeletal system development, skin development, skin morphogenesis, tooth eruption, tooth mineralization, visual perception | 5529814 | 139 | 23:161 | QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP |