Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01177 FD00068 Proteasome subunit beta type-6 P28072 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 33 cadherin binding, endopeptidase activity, threonine-type endopeptidase activity 240 Macropain delta chain, Multicatalytic endopeptidase complex delta chain, Proteasome delta chain, Proteasome subunit Y PSMB6 9606 cytoplasm, cytosol, extracellular exosome, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 1888762, 2306472 33 2:34 AATLLAARGAGPAPAWGPEAFTPDWESREVSTG
PSQ01179 FD00101 Proteasome subunit beta type-5 P28074 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 59 endopeptidase activity, peptidase activity, threonine-type endopeptidase activity 263 Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit MB1, Proteasome subunit X PSMB5 9606 centrosome, cytoplasm, cytosol, extracellular exosome, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, proteolysis, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, response to oxidative stress, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 2306472 59 1:59 MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHG
PSQ01194 FD00152 Proprotein convertase subtilisin P29122 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 86 endopeptidase activity, heparin binding, nerve growth factor binding, serine-type endopeptidase activity 969 Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin PCSK6 9606 cell surface, collagen-containing extracellular matrix, endoplasmic reticulum, extracellular region, extracellular space, Golgi lumen, membrane, plasma membrane cornification, glycoprotein metabolic process, nerve growth factor processing, nerve growth factor production, peptide hormone processing, protein processing, regulation of BMP signaling pathway, regulation of lipoprotein lipase activity, secretion by cell 9738469 86 64:149 PPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR
PSQ01217 FD00120 Caspase-14 P31944 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in execution phase of apoptosis 242 None CASP14 9606 cytoplasm, cytosol, keratin filament, mitochondrion, nucleoplasm, nucleus cornification, epidermis development, keratinization 19960512 6 147:152 EIVMVI
PSQ01243 FD00433 Fibrillin-1 P35555 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 20 calcium ion binding, extracellular matrix constituent conferring elasticity, extracellular matrix structural constituent, heparin binding, hormone activity, identical protein binding, integrin binding, protein-containing complex binding 2878 None FBN1 9606 basement membrane, collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space, microfibril activation of protein kinase A activity, anatomical structure morphogenesis, camera-type eye development, cell adhesion mediated by integrin, cellular protein metabolic process, cellular response to insulin-like growth factor stimulus, cellular response to transforming growth factor beta stimulus, embryonic eye morphogenesis, extracellular matrix organization, glucose homeostasis, glucose metabolic process, heart development, metanephros development, negative regulation of osteoclast development, negative regulation of osteoclast differentiation, post-embryonic eye morphogenesis, post-translational protein modification, protein kinase A signaling, sequestering of BMP in extracellular matrix, sequestering of TGFbeta in extracellular matrix, skeletal system development 10636927 20 25:44 ADANLEAGNVKETRASRAKR
PSQ01270 FD00315 Lysosomal acid lipase P38571 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 49 lipase activity, sterol esterase activity 399 Cholesteryl esterase, Lipase A, Sterol esterase LIPA 9606 cytosol, fibrillar center, intracellular membrane-bounded organelle, lysosomal lumen, lysosome, nucleoplasm cell morphogenesis, cell population proliferation, homeostasis of number of cells within a tissue, inflammatory response, lipid catabolic process, low-density lipoprotein particle clearance, lung development, sterol metabolic process, tissue remodeling 15269241, 8112342 49 28:76 AVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDK
PSQ01290 FD00131 Caspase-3 P42574 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 aspartic-type endopeptidase activity, cyclin-dependent protein serine/threonine kinase inhibitor activity, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, death receptor binding, peptidase activity, phospholipase A2 activator activity, protease binding, protein-containing complex binding 277 Apopain, Cysteine protease CPP32, Protein Yama, SREBP cleavage activity 1 CASP3 9606 cytoplasm, cytosol, death-inducing signaling complex, membrane raft, neuronal cell body, nucleoplasm, nucleus anterior neural tube closure, apoptotic DNA fragmentation, apoptotic process, apoptotic signaling pathway, axonal fasciculation, B cell homeostasis, cell fate commitment, cellular response to DNA damage stimulus, cellular response to staurosporine, cytokine-mediated signaling pathway, erythrocyte differentiation, execution phase of apoptosis, extrinsic apoptotic signaling pathway in absence of ligand, glial cell apoptotic process, heart development, hippo signaling, hippocampus development, intrinsic apoptotic signaling pathway in response to osmotic stress, keratinocyte differentiation, learning or memory, leukocyte apoptotic process, luteolysis, negative regulation of activated T cell proliferation, negative regulation of apoptotic process, negative regulation of B cell proliferation, neuron apoptotic process, neuron differentiation, neurotrophin TRK receptor signaling pathway, platelet formation, positive regulation of amyloid-beta formation, positive regulation of apoptotic process, positive regulation of neuron apoptotic process, protein processing, proteolysis, regulation of macroautophagy, regulation of protein stability, response to amino acid, response to antibiotic, response to cobalt ion, response to drug, response to estradiol, response to glucocorticoid, response to glucose, response to hydrogen peroxide, response to hypoxia, response to lipopolysaccharide, response to nicotine, response to tumor necrosis factor, response to UV, response to X-ray, sensory perception of sound, striated muscle cell differentiation, T cell homeostasis, wound healing 7596430 19 10:28 SKSIKNLEPKIIHGSESMD
PSQ01302 FD00039 Collagenase 3 P45452 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 84 calcium ion binding, collagen binding, endopeptidase activity, metalloendopeptidase activity, zinc ion binding 478 Matrix metalloproteinase-13 MMP13 9606 extracellular matrix, extracellular region, extracellular space bone morphogenesis, collagen catabolic process, extracellular matrix disassembly, extracellular matrix organization, proteolysis, response to amyloid-beta 8576151 84 20:103 LPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGE
PSQ01314 FD00194 Carboxypeptidase A2 P48052 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 96 carboxypeptidase activity, metallocarboxypeptidase activity, zinc ion binding 420 None CPA2 9606 extracellular region, extracellular space, vacuole protein catabolic process in the vacuole, proteolysis 8318831 96 19:114 LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRER
PSQ01325 FD00481 Caspase-4 P49662 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 CARD domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic signaling pathway 377 ICE and Ced-3 homolog 2 , ICE(rel)-II , Mih1 , Protease TX CASP4 9606 AIM2 inflammasome complex, cytoplasm, cytosol, endoplasmic reticulum, endoplasmic reticulum membrane, extracellular region, IPAF inflammasome complex, mitochondrion, NLRP3 inflammasome complex, plasma membrane, protein-containing complex apoptotic process, cellular response to amyloid-beta, execution phase of apoptosis, inflammatory response, innate immune response, intrinsic apoptotic signaling pathway, intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress, positive regulation of tumor necrosis factor-mediated signaling pathway, protein autoprocessing, proteolysis, pyroptosis, regulation of apoptotic process, regulation of inflammatory response 7797510 19 271:289 SPASLEVASSQSSENLEED
PSQ01326 FD00129 Vascular endothelial growth factor C P49767 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 80 chemoattractant activity, growth factor activity, vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor binding 420 Flt4 ligand, Vascular endothelial growth factor-related protein VEGFC 9606 extracellular region, extracellular space, membrane, platelet alpha granule lumen animal organ morphogenesis, cellular response to leukemia inhibitory factor, induction of positive chemotaxis, morphogenesis of embryonic epithelium, negative regulation of blood pressure, negative regulation of osteoblast differentiation, platelet degranulation, positive regulation of angiogenesis, positive regulation of blood vessel endothelial cell migration, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of endothelial cell proliferation, positive regulation of lymphangiogenesis, positive regulation of mast cell chemotaxis, positive regulation of mesenchymal stem cell proliferation, positive regulation of neuroblast proliferation, positive regulation of protein autophosphorylation, positive regulation of protein kinase activity, positive regulation of protein phosphorylation, positive regulation of protein secretion, regulation of vascular endothelial growth factor receptor signaling pathway, response to drug, response to hypoxia, signal transduction, sprouting angiogenesis, substrate-dependent cell migration, vascular endothelial growth factor receptor signaling pathway, vascular endothelial growth factor signaling pathway 9233800 80 32:111 FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAA
PSQ01327 FD00550 Cathelicidin antimicrobial peptide P49913 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 101 lipopolysaccharide binding 170 18 kDa cationic antimicrobial protein CAMP 9606 extracellular exosome, extracellular region, extracellular space, specific granule, specific granule lumen, tertiary granule lumen antibacterial humoral response, antifungal humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, chronic inflammatory response, cytolysis by host of symbiont cells, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response, innate immune response in mucosa, killing by host of symbiont cells, modulation of process of other organism, neutrophil degranulation, positive regulation of interleukin-8 production, response to yeast 7615076 101 31:131 QVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKR
PSQ01329 FD00587 Matrix metalloproteinase-14 P50281 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 91 endopeptidase activity, integrin binding, metalloaminopeptidase activity, metalloendopeptidase activity, zinc ion binding 582 MMP-X1, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase MMP14 9606 cytoplasmic vesicle, cytosol, extracellular matrix, extracellular space, focal adhesion, Golgi lumen, integral component of plasma membrane, intermediate filament cytoskeleton, macropinosome, melanosome, nucleus, plasma membrane angiogenesis, astrocyte cell migration, branching morphogenesis of an epithelial tube, cell motility, chondrocyte proliferation, collagen catabolic process, craniofacial suture morphogenesis, embryonic cranial skeleton morphogenesis, endochondral ossification, endodermal cell differentiation, endothelial cell proliferation, extracellular matrix disassembly, extracellular matrix organization, head development, lung development, male gonad development, negative regulation of focal adhesion assembly, negative regulation of Notch signaling pathway, ovarian follicle development, positive regulation of B cell differentiation, positive regulation of cell growth, positive regulation of cell migration, positive regulation of macrophage migration, positive regulation of myotube differentiation, positive regulation of protein processing, protein processing, proteolysis, regulation of protein localization to plasma membrane, response to estrogen, response to hypoxia, response to mechanical stimulus, response to odorant, response to organic cyclic compound, response to oxidative stress, skeletal system development, tissue remodeling, zymogen activation 8804434 91 21:111 ALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKR
PSQ01339 FD00499 Dipeptidyl peptidase 1 P53634 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 96 chaperone binding, chloride ion binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, dipeptidyl-peptidase activity, identical protein binding, peptidase activator activity involved in apoptotic process, phosphatase binding, protein self-association, serine-type endopeptidase activity 463 Cathepsin C, Cathepsin J, Dipeptidyl peptidase I, Dipeptidyl transferase CTSC 9606 azurophil granule lumen, centrosome, collagen-containing extracellular matrix, COPII-coated ER to Golgi transport vesicle, endoplasmic reticulum lumen, endoplasmic reticulum-Golgi intermediate compartment membrane, extracellular exosome, extracellular region, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosome, membrane, nucleoplasm aging, COPII vesicle coating, endoplasmic reticulum to Golgi vesicle-mediated transport, immune response, negative regulation of myelination, neutrophil degranulation, positive regulation of apoptotic signaling pathway, positive regulation of microglial cell activation, positive regulation of proteolysis involved in cellular protein catabolic process, proteolysis, proteolysis involved in cellular protein catabolic process, response to organic substance, T cell mediated cytotoxicity 1586157, 7665576, 9507095 96 135:230 ACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILH
PSQ01344 FD00297 Small ubiquitin-related modifier 3 P55854 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 protein tag, ubiquitin-like protein ligase binding 103 SMT3 homolog 1 , SUMO-2 , Ubiquitin-like protein SMT3A SUMO3 9606 cytoplasm, kinetochore, nucleoplasm, nucleus, PML body negative regulation of DNA binding, protein sumoylation, regulation of protein localization to nucleus 15487983, 16608850 11 93:103 VPESSLAGHSF
PSQ01363 FD00126 Beta-secretase 1 P56817 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 24 amyloid-beta binding, aspartic-type endopeptidase activity, endopeptidase activity, enzyme binding, peptidase activity 501 Aspartyl protease 2 , Beta-site amyloid precursor protein cleaving enzyme 1, Memapsin-2 , Membrane-associated aspartic protease 2 BACE1 9606 axon, cell surface, cytoplasmic vesicle membrane, dendrite, early endosome, endoplasmic reticulum lumen, endosome, endosome membrane, Golgi apparatus, Golgi-associated vesicle lumen, hippocampal mossy fiber to CA3 synapse, integral component of membrane, integral component of plasma membrane, late endosome, lysosome, membrane, membrane raft, multivesicular body, neuronal cell body, plasma membrane, recycling endosome, synaptic vesicle, trans-Golgi network amyloid fibril formation, amyloid precursor protein catabolic process, amyloid-beta formation, amyloid-beta metabolic process, cellular response to amyloid-beta, cellular response to copper ion, cellular response to manganese ion, detection of mechanical stimulus involved in sensory perception of pain, membrane protein ectodomain proteolysis, positive regulation of neuron apoptotic process, prepulse inhibition, protein processing, proteolysis, regulation of synaptic vesicle exocytosis, response to lead ion, response to radiation 10591214 24 22:45 TQHGIRLPLRSGLGGAPLGLRLPR
PSQ01390 FD00484 Beta-defensin 1 P60022 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 CCR6 chemokine receptor binding, identical protein binding 68 Defensin DEFB1 9606 extracellular exosome, extracellular region, extracellular space, extrinsic component of membrane, Golgi lumen, microvesicle, sperm midpiece antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, calcium-mediated signaling using intracellular calcium source, cAMP-mediated signaling, chemotaxis, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, G protein-coupled receptor signaling pathway, immune response, innate immune response, innate immune response in mucosa, positive regulation of flagellated sperm motility involved in capacitation, response to bacterium 7628632 11 22:32 GNFLTGLGHRS
PSQ01426 FD00416 Disintegrin and metalloproteinase domain-containing protein 17 P78536 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 197 endopeptidase activity, integrin binding, interleukin-6 receptor binding, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, Notch binding, PDZ domain binding, peptidase activity, SH3 domain binding 824 Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme ADAM17 9606 actin cytoskeleton, apical plasma membrane, cell surface, cytoplasm, cytosol, endoplasmic reticulum lumen, Golgi membrane, integral component of plasma membrane, membrane, membrane raft, plasma membrane amyloid precursor protein catabolic process, B cell differentiation, cell adhesion, cell adhesion mediated by integrin, cell motility, cellular response to high density lipoprotein particle stimulus, defense response to Gram-positive bacterium, epidermal growth factor receptor signaling pathway, germinal center formation, membrane protein ectodomain proteolysis, membrane protein intracellular domain proteolysis, negative regulation of cold-induced thermogenesis, negative regulation of inflammatory response to antigenic stimulus, negative regulation of transforming growth factor beta receptor signaling pathway, neutrophil mediated immunity, Notch receptor processing, Notch signaling pathway, positive regulation of blood vessel endothelial cell migration, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of cellular component movement, positive regulation of chemokine production, positive regulation of cyclin-dependent protein serine/threonine kinase activity, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of G1/S transition of mitotic cell cycle, positive regulation of leukocyte chemotaxis, positive regulation of protein phosphorylation, positive regulation of T cell chemotaxis, positive regulation of transforming growth factor beta receptor signaling pathway, positive regulation of tumor necrosis factor-mediated signaling pathway, positive regulation of vascular endothelial cell proliferation, protein processing, proteolysis, receptor transactivation, regulation of mast cell apoptotic process, response to drug, response to hypoxia, response to lipopolysaccharide, spleen development, T cell differentiation in thymus, tumor necrosis factor-mediated signaling pathway, wound healing, spreading of epidermal cells 9034191 197 18:214 PRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKR
PSQ01469 FD00444 Dermcidin P81605 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 13 peptidase activity, RNA binding 110 Preproteolysin DCD 9606 extracellular exosome, extracellular region, extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, defense response to bacterium, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing by host of symbiont cells, killing of cells of other organism 11694882 13 50:62 GLARQAPKPRKQR
PSQ01595 FD00155 Pro-neuregulin-1 Q02297 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 chemorepellent activity, cytokine activity, ErbB-3 class receptor binding, growth factor activity, integrin binding, protein tyrosine kinase activator activity, receptor tyrosine kinase binding, signaling receptor binding, transcription coregulator activity, transmembrane receptor protein tyrosine kinase activator activity 640 None NRG1 9606 apical plasma membrane, extracellular region, extracellular space, glutamatergic synapse, integral component of membrane, integral component of postsynaptic density membrane, integral component of presynaptic active zone membrane, membrane, nucleoplasm, plasma membrane activation of MAPK activity, activation of protein kinase B activity, activation of transmembrane receptor protein tyrosine kinase activity, animal organ development, cardiac muscle cell differentiation, cardiac muscle cell myoblast differentiation, cell communication, cell differentiation, cell population proliferation, cellular protein complex disassembly, endocardial cell differentiation, ERBB signaling pathway, ERBB2 signaling pathway, ERBB3 signaling pathway, ERBB4 signaling pathway, intracellular signal transduction, mammary gland development, MAPK cascade, negative regulation of cardiac muscle cell apoptotic process, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of secretion, negative regulation of transcription, DNA-templated, nervous system development, neural crest cell development, positive regulation of cardiac muscle cell proliferation, positive regulation of cell adhesion, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of peptidyl-tyrosine autophosphorylation, positive regulation of protein kinase B signaling, positive regulation of protein-containing complex assembly, positive regulation of striated muscle cell differentiation, regulation of cell motility, regulation of postsynaptic neurotransmitter receptor internalization, synaptic membrane adhesion, transmembrane receptor protein tyrosine kinase signaling pathway, ventricular cardiac muscle cell differentiation, ventricular trabecula myocardium morphogenesis, wound healing 7689552 19 1:19 MSERKEGRGKGKGKKKERG
Go to Lab Web Page