Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00753

ProSeqID PSQ00753
Family FD00010
Protein Name Phospholipase A2
UniProt ID P04054
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 7
Functions bile acid binding, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), signaling receptor binding
Preproprotein Length (aa) 148
Alt Name Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B
Gene Name PLA2G1B
NCBI ID 9606
Cellular Localization cell surface, extracellular region, extracellular space, secretory granule
Processes actin filament organization, activation of MAPK activity, activation of phospholipase A2 activity, antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, arachidonic acid secretion, cellular response to insulin stimulus, defense response to Gram-positive bacterium, fatty acid biosynthetic process, innate immune response in mucosa, intracellular signal transduction, leukotriene biosynthetic process, lipid catabolic process, neutrophil chemotaxis, neutrophil mediated immunity, phosphatidic acid biosynthetic process, phosphatidylcholine acyl-chain remodeling, phosphatidylcholine metabolic process, phosphatidylethanolamine acyl-chain remodeling, phosphatidylglycerol acyl-chain remodeling, phosphatidylglycerol metabolic process, phosphatidylinositol acyl-chain remodeling, phosphatidylserine acyl-chain remodeling, positive regulation of calcium ion transport into cytosol, positive regulation of cell population proliferation, positive regulation of fibroblast proliferation, positive regulation of glomerular visceral epithelial cell apoptotic process, positive regulation of immune response, positive regulation of interleukin-8 production, positive regulation of NF-kappaB transcription factor activity, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, regulation of glucose import, signal transduction
PubMed 6349696
Total Prosequence Length (aa) 7
Prosequence Location 16:22
Prosequence Sequence DSGISPR
Preproprotein Sequence MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS