| ProSeqID | PSQ00820 |
| Family | FD00017 |
| Protein Name | Coagulation factor VII |
| UniProt ID | P08709 |
| Taxonomy | Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms | Homo sapiens (Human) |
| Prosequence Length (aa) | 40 |
| Functions | calcium ion binding, serine-type endopeptidase activity, serine-type peptidase activity, signaling receptor binding |
| Preproprotein Length (aa) | 466 |
| Alt Name | Proconvertin, Serum prothrombin conversion accelerator |
| Gene Name | F7 |
| NCBI ID | 9606 |
| Cellular Localization | collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, plasma membrane, serine-type peptidase complex, vesicle |
| Processes | animal organ regeneration, blood coagulation, blood coagulation, extrinsic pathway, circadian rhythm, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of blood coagulation, extrinsic pathway, positive regulation of blood coagulation, positive regulation of cell migration, positive regulation of leukocyte chemotaxis, positive regulation of platelet-derived growth factor receptor signaling pathway, positive regulation of positive chemotaxis, positive regulation of protein kinase B signaling, protein processing, response to 2,3,7,8-tetrachlorodibenzodioxine, response to anticoagulant, response to astaxanthin, response to carbon dioxide, response to cholesterol, response to estradiol, response to estrogen, response to genistein, response to growth hormone, response to hypoxia, response to Thyroid stimulating hormone, response to thyrotropin-releasing hormone, response to thyroxine, response to vitamin K |
| PubMed | 3264725 |
| Total Prosequence Length (aa) | 40 |
| Prosequence Location | 21:60 |
| Prosequence Sequence | AGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRR |
| Preproprotein Sequence | MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP |