Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01101 FD00170 Proteasome subunit beta type-1 P18421 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 27 endopeptidase activity, threonine-type endopeptidase activity 240 Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome component C5, Proteasome gamma chain Psmb1 10116 cytoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process 2335242 27 1:27 MLSTAAYRDPDRELVMGPQGSAGPVQM
PSQ01102 FD00015 Zinc metalloproteinase P18619 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) 18 metal ion binding, metalloendopeptidase activity, toxin activity 483 None None 88087 extracellular region None 1516704, 2364514 18 396:413 LRTDTVSTPVSGNEFLEA
PSQ01103 FD00007 Factor V activator RVV-V gamma P18965 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Daboia Daboia siamensis (Eastern Russel 6 serine-type endopeptidase activity, toxin activity 260 Russel, Snake venom serine protease None 343250 extracellular region None 3053712 6 19:24 QKSSEL
PSQ01104 FD00010 Phospholipase A2 homolog mojave toxin acidic chain P18998 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus Crotalus scutulatus scutulatus (Mojave rattlesnake) 7 calcium ion binding, phospholipase A2 activity, toxin activity 138 None None 8738 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 2310754 7 120:126 DYKYLRF
PSQ01105 FD00004 Haptoglobin P19006 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Carnivora Caniformia Canidae Canis Canis lupus familiaris (Dog) (Canis familiaris) 186 antioxidant activity, hemoglobin binding, serine-type endopeptidase activity 329 None HP 9615 blood microparticle, extracellular space acute inflammatory response, acute-phase response, defense response to bacterium, immune system process, positive regulation of cell death, zymogen activation 8461423, 975782 186 84:269 RIMGGSVDAKGSFPWQAKMVSHHNLTSGATLINEQWLLTTAKNLFLGHKDDAKANDIAPTLKLYVGKNQLVEVEKVVLHPDYSKVDIGLIKLKQKVPIDERVMPICLPSKDYAEVGRIGYVSGWGRNSNFNFTELLKYVMLPVADQDKCVQHYEGSTVPEKKSPKSPVGVQPILNEHTFCAGMSKF
PSQ01106 FD00205 Carboxypeptidase B P19223 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 95 carboxypeptidase activity, metallocarboxypeptidase activity, zinc ion binding 420 None Cpb1 10116 extracellular space proteolysis 1898371 95 14:108 HASEEHFDGNRVYRVSVHGEDHVNLIQELANTKEIDFWKPDSATQVKPLTTVDFHVKAEDVADVENFLEENEVHYEVLISNVRNALESQFDSHTR
PSQ01107 FD00004 Mastin P19236 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Carnivora Caniformia Canidae Canis Canis lupus familiaris (Dog) (Canis familiaris) 15 serine-type endopeptidase activity 280 Mast cell protease 3, Mastocytoma protease None 9615 cytoplasm, extracellular space proteolysis 7768912 15 16:30 VPISPDPGLRHEQVG
PSQ01108 FD00331 Lantibiotic Pep5 P19578 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 26 signaling receptor binding 60 None pepA 1282 None cytolysis, defense response to bacterium 2253617 26 1:26 MKNNKNLFDLEIKKETSQNTDELEPQ
PSQ01109 FD00023 Cathelicidin-2 P19660 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 101 lipopolysaccharide binding 180 Bactenecin-5, PR-42 CATHL2 9913 extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response 2229048 101 30:130 QALSYREAVLRAVDQFNERSSEANLYRLLELDPTPNDDLDPGTRKPVSFRVKETDCPRTSQQPLEQCDFKENGLVKQCVGTVTLDPSNDQFDINCNELQSV
PSQ01110 FD00023 Cathelicidin-3 P19661 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 101 None 190 Bactenecin-7, PR-59 CATHL3 9913 extracellular region defense response to bacterium 2229048 101 30:130 QALSYREAVLRAVDRINERSSEANLYRLLELDPPPKDVEDRGARKPTSFTVKETVCPRTSPQPPEQCDFKENGLVKQCVGTITLDQSDDLFDLNCNELQSV
PSQ01111 FD00323 Inter-alpha-trypsin inhibitor heavy chain H1 P19827 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 7 calcium ion binding, serine-type endopeptidase inhibitor activity 911 Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein ITIH1 9606 blood microparticle, collagen-containing extracellular matrix, extracellular exosome, extracellular region hyaluronan metabolic process 2476436 7 28:34 LGSATGR
PSQ01112 FD00184 Elafin P19957 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 38 endopeptidase inhibitor activity, serine-type endopeptidase inhibitor activity, structural constituent of skin epidermis 120 Elastase-specific inhibitor, Peptidase inhibitor 3, Protease inhibitor WAP3, Skin-derived antileukoproteinase, WAP four-disulfide core domain protein 14 PI3 9606 cornified envelope, cytosol, extracellular matrix, extracellular region, extracellular space antibacterial humoral response, antimicrobial humoral response, copulation, cornification, innate immune response, peptide cross-linking 1536690, 2394696 38 23:60 AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
PSQ01113 FD00004 Azurocidin P20160 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 7 heparan sulfate proteoglycan binding, heparin binding, peptidase activity, serine-type endopeptidase activity, toxic substance binding 251 Cationic antimicrobial protein CAP37 , Heparin-binding protein AZU1 9606 azurophil granule, azurophil granule lumen, azurophil granule membrane, extracellular exosome, extracellular region, extracellular space, extrinsic component of membrane, intracellular membrane-bounded organelle antimicrobial humoral response, calcium-mediated signaling using intracellular calcium source, cell chemotaxis, cellular extravasation, defense response to Gram-negative bacterium, defense response to virus, glial cell migration, induction of positive chemotaxis, inflammatory response, macrophage chemotaxis, microglial cell activation, monocyte activation, negative regulation of apoptotic process, neutrophil degranulation, neutrophil-mediated killing of bacterium, positive regulation of cell adhesion, positive regulation of fractalkine production, positive regulation of gene expression, positive regulation of interleukin-1 beta production, positive regulation of MHC class II biosynthetic process, positive regulation of peptidyl-threonine phosphorylation, positive regulation of phagocytosis, positive regulation of protein kinase activity, positive regulation of tumor necrosis factor production, protein kinase C signaling, protein kinase C-activating G protein-coupled receptor signaling pathway, proteolysis, regulation of vascular permeability 10534120, 1399008, 1897955, 1937776, 2026172, 2226832, 2332502, 2404977, 2406527, 2501794 7 20:26 GSSPLLD
PSQ01114 FD00013 Zinc metalloproteinase-disintegrin-like HR1b P20164 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) 171 metal ion binding, metalloendopeptidase activity, toxin activity 614 Snake venom metalloproteinase, Trimerelysin I, Trimerelysin-1 None 88087 extracellular region None 2398046 171 21:191 IILESGNVNDYEVMYPQKVAALPKGAVQQKYEDTMQYEFKVNGEPVVLHLEKNKGLFSEDYSETHYSPDGREITTNPPVEDHCYYHGRIQNDADSTASISACNGLKGHFKLQGEMYLIEPLKFSDSEAHAVYKYENVEKEEEAPKMCGVTQTNWESDEPIKKASKLVVTAE
PSQ01115 FD00109 Neurotrophin-3 P20181 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 121 chemoattractant activity, growth factor activity, nerve growth factor binding, nerve growth factor receptor binding, neurotrophin p75 receptor binding 258 HDNF, Nerve growth factor 2, Neurotrophic factor Ntf3 10090 axon, cytoplasmic vesicle, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, synaptic vesicle activation of GTPase activity, activation of MAPK activity, activation of protein kinase B activity, axon guidance, brain development, enteric nervous system development, epidermis development, generation of neurons, glial cell fate determination, induction of positive chemotaxis, mechanoreceptor differentiation, memory, modulation of chemical synaptic transmission, myelination, negative regulation of neuron apoptotic process, negative regulation of peptidyl-tyrosine phosphorylation, nerve development, nerve growth factor signaling pathway, nervous system development, neuromuscular synaptic transmission, neuron development, neuron projection morphogenesis, peripheral nervous system development, positive regulation of actin cytoskeleton reorganization, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of glial cell differentiation, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of receptor internalization, positive regulation of transcription by RNA polymerase II, regulation of apoptotic process, regulation of neuron apoptotic process, regulation of neuron differentiation, smooth muscle cell differentiation, transmembrane receptor protein tyrosine kinase signaling pathway 7957235 121 19:139 NSMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPEQGEATRSEFQPMIATDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSPRRKR
PSQ01116 FD00075 Zona pellucida sperm-binding protein 2 P20239 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 80 acrosin binding, identical protein binding, structural constituent of egg coat 720 Zona pellucida glycoprotein 2, Zona pellucida protein A Zp2 10090 collagen-containing extracellular matrix, egg coat, endoplasmic reticulum, extracellular region, integral component of membrane, multivesicular body, plasma membrane binding of sperm to zona pellucida, prevention of polyspermy 12799386, 26811476 80 634:713 KREANKEDTMTVSLPGPILLLSDVSSSKGVDPSSSEITKDIIAKDIASKTLGAVAALVGSAVILGFICYLYKKRTIRFNH
PSQ01117 FD00447 Gelsolin P20305 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 16 actin filament binding, calcium ion binding, phosphatidylinositol-4,5-bisphosphate binding 779 Actin-depolymerizing factor, Brevin GSN 9823 actin cytoskeleton, cytoplasm, cytosol, extracellular region, extracellular space actin filament depolymerization, actin filament polymerization, actin filament severing, actin nucleation, actin polymerization or depolymerization, barbed-end actin filament capping, cell projection assembly, central nervous system development, cilium assembly 3023087 16 18:33 ATASRGAPQARAPQGR
PSQ01118 FD00170 Proteasome subunit beta type-1 P20618 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 28 endopeptidase activity, threonine-type endopeptidase activity 241 Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome component C5, Proteasome gamma chain PSMB1 9606 cytoplasm, cytosol, extracellular exosome, extracellular region, ficolin-1-rich granule lumen, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex, secretory granule lumen anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, neutrophil degranulation, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 2306472 28 1:28 MLSSTAMYSAPGRDLGMEPHRAAGPLQL
PSQ01119 FD00190 Type IV major alpha-pilin P20657 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Moraxella Moraxella bovis 6 None 159 Alpha-pilin, Fimbrial protein I, I pilin tfpI 476 integral component of membrane, pilus cell adhesion 2902184 6 1:6 MNAQKG
PSQ01120 FND00222 Toxin TxP-I P20798 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Acariformes Trombidiformes Prostigmata Eleutherengona Heterostigmata Pyemotoidea Pyemotidae Pyemotes Pyemotes tritici (Straw itch mite) (Acarus tritici) 13 toxin activity 279 Tox34 None 6950 extracellular region None 2815110 13 15:27 VKPFRSFNNISLI
PSQ01121 FD00037 C-type natriuretic peptide 1 P20968 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Lithobates Lithobates catesbeianus (American bullfrog) (Rana catesbeiana) 83 hormone activity 129 None None 8400 extracellular region cGMP biosynthetic process, growth plate cartilage chondrocyte differentiation, growth plate cartilage chondrocyte proliferation, receptor guanylyl cyclase signaling pathway 2148082 83 25:107 KPLSSLQNLSRLLEDNFERSFGSDEADQQLVPTDSLDQLDPELQWNKNRLEQGDSPHVNEMTLQQLLNDPVGTSRRYRQRNKK
PSQ01122 FD00463 Ferredoxin P21149 Eukaryota Metamonada Parabasalia Trichomonadida Trichomonadidae Trichomonas Trichomonas vaginalis 8 2 iron, 2 sulfur cluster binding, electron transfer activity, metal ion binding 100 None None 5722 hydrogenosome None 1696716 8 1:8 MLSQVCRF
PSQ01123 FD00125 Brain-derived neurotrophic factor P21237 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 112 growth factor activity, nerve growth factor receptor binding, neurotrophin TRKB receptor binding 249 None Bdnf 10090 axon, cytoplasm, cytoplasmic vesicle, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, mitochondrial crista, mitochondrion, neuronal cell body, nuclear speck, perikaryon, perinuclear region of cytoplasm, postsynapse, secretory granule, synaptic vesicle, terminal bouton axon extension, axon guidance, axon target recognition, behavioral fear response, behavioral response to cocaine, circadian rhythm, collateral sprouting, dendrite development, dendrite extension, excitatory postsynaptic potential, fear response, feeding behavior, gamma-aminobutyric acid signaling pathway, glutamate secretion, inhibitory postsynaptic potential, inner ear development, learning, learning or memory, mechanoreceptor differentiation, memory, mitochondrial electron transport, NADH to ubiquinone, modulation of chemical synaptic transmission, negative regulation of apoptotic process, negative regulation of apoptotic signaling pathway, negative regulation of cell death, negative regulation of myotube differentiation, negative regulation of neuroblast proliferation, negative regulation of neuron apoptotic process, negative regulation of neuron death, negative regulation of striated muscle tissue development, negative regulation of synaptic transmission, GABAergic, nerve development, nerve growth factor signaling pathway, nervous system development, neuron projection extension, neuron projection morphogenesis, neuron recognition, peripheral nervous system development, positive regulation of collateral sprouting, positive regulation of DNA-binding transcription factor activity, positive regulation of glucocorticoid receptor signaling pathway, positive regulation of long-term neuronal synaptic plasticity, positive regulation of neuron differentiation, positive regulation of neuron projection development, positive regulation of peptidyl-serine phosphorylation, positive regulation of receptor binding, positive regulation of synapse assembly, regeneration, regulation of axon extension, regulation of collateral sprouting, regulation of long-term neuronal synaptic plasticity, regulation of metabolic process, regulation of neuron apoptotic process, regulation of neuron differentiation, regulation of retinal cell programmed cell death, regulation of short-term neuronal synaptic plasticity, regulation of synaptic plasticity, response to drug, retrograde trans-synaptic signaling by neuropeptide, modulating synaptic transmission, synapse assembly, taste bud development, transmembrane receptor protein tyrosine kinase signaling pathway, ureteric bud development 7957235 112 19:130 APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR
PSQ01124 FND00360 Pol-RFamide neuropeptides P21259 Eukaryota Metazoa Cnidaria Hydrozoa Hydroidolina Anthoathecata Capitata Polyorchidae Polyorchis Polyorchis penicillatus (Hydromedusa) 31 None 287 None None 6091 extracellular region neuropeptide signaling pathway 2905621 31 22:52 DEKTSSALENEIVEILNGNFKNEKKSIETSD
PSQ01125 FD00281 Zinc metalloproteinase P21347 Bacteria Proteobacteria Gammaproteobacteria Legionellales Legionellaceae Legionella Legionella pneumophila 183 metal ion binding, metalloendopeptidase activity 543 PEP1, PRO A None 446 extracellular region None 2110146 183 25:207 ADPIPLQKSSFSEVTQKFQLTLPGVMKGAVVSTNSLQFIRQHTDGNKVTHVRMQQQYAGFPVFGGYAILHSKNATPSLATAKSDEKMNGVIYDGLQAELGQPKPSFVKNASMALQQFKDKYANKQVSEDQVTPMIYIDEKHQAHWAYKVSVLVIHDDRIPERPTAIIDAETNKPFVQWDDVKT
PSQ01126 FD00162 Serine carboxypeptidase 3 P21529 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) 61 serine-type carboxypeptidase activity 508 CP-MIII, Serine carboxypeptidase III CBP3 4513 extracellular region None 2639682 61 20:80 AAGALRLPPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGEGNEDVAPGQLLERRVT
PSQ01127 FD00039 Interstitial collagenase P21692 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 80 metalloendopeptidase activity, peptidase activity, serine-type endopeptidase activity, zinc ion binding 469 Matrix metalloproteinase-1 MMP1 9823 extracellular matrix, extracellular region cellular response to UV-A, collagen catabolic process, extracellular matrix organization 7840605 80 20:99 PAATSETQEQDVEIVQKYLKNYYNLNSDGVPVEKKRNSGLVVEKLKQMQQFFGLKVTGKPDAETLNVMKQPRCGVPDVAE
PSQ01128 FD00254 Decorin P21793 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 14 collagen binding, collagen fibril binding, extracellular matrix binding, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding, protein homodimerization activity 360 Bone proteoglycan II, PG-S2 DCN 9913 collagen-containing extracellular matrix, extracellular space negative regulation of angiogenesis, negative regulation of collagen fibril organization, negative regulation of endothelial cell migration, negative regulation of vascular endothelial growth factor signaling pathway, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan, positive regulation of macroautophagy, positive regulation of mitochondrial depolarization, positive regulation of mitochondrial fission, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of transcription by RNA polymerase II 2914936 14 17:30 GPFQQKGLFDFMLE
PSQ01129 FD00172 Biglycan P21809 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 21 extracellular matrix binding, glycosaminoglycan binding 369 Bone, Leucine-rich PG I, PG-S1 BGN 9913 cell surface, extracellular matrix, extracellular region, extracellular space, sarcolemma, transport vesicle articular cartilage development, bone development, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan 2656687, 2914936 21 17:37 LPFEQKAFWDFTLDDGLPMLN
PSQ01130 FD00172 Biglycan P21810 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 21 extracellular matrix binding, extracellular matrix structural constituent, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding 368 Bone, PG-S1 BGN 9606 cell surface, collagen-containing extracellular matrix, extracellular exosome, extracellular matrix, extracellular region, extracellular space, Golgi lumen, lysosomal lumen, sarcolemma, transport vesicle articular cartilage development, blood vessel remodeling, bone development, chondroitin sulfate biosynthetic process, chondroitin sulfate catabolic process, dermatan sulfate biosynthetic process, extracellular matrix organization, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan 2590169, 3597437 21 17:37 LPFEQRGFWDFTLDDGPFMMN
PSQ01131 FD00471 Lantibiotic gallidermin P21838 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus gallinarum 30 signaling receptor binding 59 None gdmA 1293 extracellular region cytolysis, defense response to bacterium 3181159 30 1:30 MEAVKEKNELFDLDVKVNAKESNDSGAEPR
PSQ01132 FD00004 Tryptase beta-2 P21845 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 10 heparin binding, identical protein binding, peptidase activity, serine-type endopeptidase activity 276 Mast cell protease 6 Tpsb2 10090 extracellular region, extracellular space inflammatory response, proteolysis 2326280 10 22:31 APRPANQRVG
PSQ01133 FD00213 Proclotting enzyme P21902 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Merostomata Xiphosura Limulidae Tachypleus Tachypleus tridentatus (Japanese horseshoe crab) 6 metal ion binding, serine-type endopeptidase activity, serine-type peptidase activity 375 None None 6853 extracellular region, transport vesicle hemolymph coagulation, protein processing 2266134 6 22:27 STLSRQ
PSQ01134 FD00148 Eosinophil granule major basic protein 1 P22032 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Hystricomorpha Caviidae Cavia Cavia porcellus (Guinea pig) 99 carbohydrate binding 240 None MBP1 10141 None defense response to bacterium, immune response 1705901 99 16:114 TRHLKVDTSSLQSLRGEESLAQDGETAEGATREATAGALMPLPEEEEMEGASGSEDDPEEEEEEEEEVEFSSELDVSPEDIQCPKEEDTVKFFSRPGYK
PSQ01135 FD00069 Lactoperoxidase P22079 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 54 heme binding, metal ion binding, peroxidase activity, thiocyanate peroxidase activity 719 Salivary peroxidase LPO 9606 basolateral plasma membrane, cytoplasm, extracellular exosome, extracellular region, extracellular space cell redox homeostasis, defense response to bacterium, detection of chemical stimulus involved in sensory perception of bitter taste, hydrogen peroxide catabolic process, response to oxidative stress 10715594 54 27:80 QTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAMSSETPTSRQLSEYLKHAKGR
PSQ01136 FD00023 Cathelicidin-1 P22226 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 114 lipopolysaccharide binding 155 Bactenecin-1, Cyclic dodecapeptide CATHL1 9913 extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, cytolysis, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response 3290210 114 30:143 QALSYREAVLRAVDQLNEQSSEPNIYRLLELDQPPQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCDFKENGLLKRCEGTVTLDQVRGNFDITCNNHQSIRITKQPWAPPQAA
PSQ01137 FD00392 Iduronate 2-sulfatase P22304 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 8 calcium ion binding, iduronate-2-sulfatase activity, sulfuric ester hydrolase activity 550 Alpha-L-iduronate sulfate sulfatase IDS 9606 lysosomal lumen, lysosome chondroitin sulfate catabolic process, glycosaminoglycan catabolic process 2122463 8 26:33 SETQANST
PSQ01138 FD00198 Germination protease P22321 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus megaterium (strain ATCC 12872 15 metalloendopeptidase activity 370 GPR endopeptidase, Germination proteinase, Spore protease gpr 545693 None spore germination 1840582 15 1:15 MEKELDLSQYSVRTD
PSQ01139 FD00198 Germination protease P22322 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 16 metalloendopeptidase activity 368 GPR endopeptidase, Germination proteinase, Spore protease gpr 224308 None spore germination 8478323 16 1:16 MKKSELDVNQYLIRTD
PSQ01140 FD00454 Endothelin-1 P22388 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 25 cytokine activity, endothelin A receptor binding, endothelin B receptor binding, hormone activity, signaling receptor binding 202 Preproendothelin-1 Edn1 10116 basal part of cell, cytoplasm, extracellular space, rough endoplasmic reticulum lumen, Weibel-Palade body adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway, artery smooth muscle contraction, blood vessel morphogenesis, body fluid secretion, branching involved in blood vessel morphogenesis, calcium-mediated signaling, cartilage development, cell surface receptor signaling pathway, cell-cell signaling, cellular calcium ion homeostasis, cellular response to calcium ion, cellular response to drug, cellular response to fatty acid, cellular response to glucocorticoid stimulus, cellular response to hypoxia, cellular response to interferon-gamma, cellular response to interleukin-1, cellular response to mineralocorticoid stimulus, cellular response to peptide hormone stimulus, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, dorsal/ventral pattern formation, endothelin receptor signaling pathway, epithelial fluid transport, G protein-coupled receptor signaling pathway, heart development, histamine secretion, in utero embryonic development, inositol phosphate-mediated signaling, intracellular signal transduction, maternal process involved in parturition, membrane depolarization, middle ear morphogenesis, multicellular organism aging, negative regulation of cellular protein metabolic process, negative regulation of gene expression, negative regulation of hormone secretion, negative regulation of nitric-oxide synthase biosynthetic process, negative regulation of smooth muscle cell apoptotic process, negative regulation of transcription by RNA polymerase II, neural crest cell development, nitric oxide transport, peptide hormone secretion, phosphatidylinositol 3-kinase signaling, phospholipase D-activating G protein-coupled receptor signaling pathway, positive regulation of cardiac muscle hypertrophy, positive regulation of cell growth involved in cardiac muscle cell development, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of cell size, positive regulation of chemokine-mediated signaling pathway, positive regulation of cytosolic calcium ion concentration, positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway, positive regulation of DNA-binding transcription factor activity, positive regulation of heart rate, positive regulation of hormone secretion, positive regulation of JUN kinase activity, positive regulation of MAP kinase activity, positive regulation of mitotic nuclear division, positive regulation of neutrophil chemotaxis, positive regulation of NIK/NF-kappaB signaling, positive regulation of odontogenesis, positive regulation of prostaglandin secretion, positive regulation of prostaglandin-endoperoxide synthase activity, positive regulation of renal sodium excretion, positive regulation of sarcomere organization, positive regulation of signaling receptor activity, positive regulation of smooth muscle cell proliferation, positive regulation of smooth muscle contraction, positive regulation of transcription by RNA polymerase II, positive regulation of urine volume, positive regulation of vascular associated smooth muscle cell proliferation, prostaglandin biosynthetic process, protein kinase C deactivation, protein kinase C-activating G protein-coupled receptor signaling pathway, regulation of blood pressure, regulation of glucose transmembrane transport, regulation of pH, regulation of sensory perception of pain, regulation of systemic arterial blood pressure by endothelin, regulation of vasoconstriction, respiratory gaseous exchange by respiratory system, response to activity, response to amino acid, response to dexamethasone, response to drug, response to hypoxia, response to leptin, response to lipopolysaccharide, response to muscle stretch, response to nicotine, response to ozone, response to prostaglandin F, response to salt, response to testosterone, response to transforming growth factor beta, rhythmic excitation, sensory perception of pain, skeletal system development, superoxide anion generation, vasoconstriction, vein smooth muscle contraction 26479776 25 26:50 AELSPRAEKEVQSPPPSTSWRPRRS
PSQ01141 FD00161 Pulmonary surfactant-associated protein C P22398 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 23 None 188 Pulmonary surfactant-associated proteolipid SPL(Val) SFTPC 9986 extracellular space respiratory gaseous exchange by respiratory system 2015882 23 1:23 MDMGSKEALMESPPDYSAAPRGR
PSQ01142 FD00532 Bone morphogenetic protein 3 P22444 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 343 BMP receptor binding, cytokine activity, growth factor activity 480 Osteogenin BMP3 9913 extracellular space cartilage development, osteoblast differentiation, positive regulation of pathway-restricted SMAD protein phosphorylation, SMAD protein signal transduction 2547759 343 23:365 QRLRQPFPELRVAVPADRAAGGGPESPLQPLDQVSEHMLRLYDRYSGGRTEEARTPGNSERGSPSLRPQPLREGNTVRSFRAGAAGMLENKELHIFNLTSLTKSENILSATLYFYIRELINISLSCPVSQECSHHAQRKHIQIDLSAWILKSSGNQSQLLGHLSVDGGKPHRDFVSWLSKDITQLLRKAKENEEFLIGFNITTKGHQLPKKMTPSPEPYILVYANDAAISEPESVVSSLQGHRNFPTGAVPKLDSQSRSAPSIERRRRKRSTGVLLPLQNNELPGAEYQYKEDEVWEERKPYKTLQTQPPDKSKNKKKQRKGPQQKSQTLQFDEQTLKKARRK
PSQ01143 FD00017 Coagulation factor VII P22457 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 17 calcium ion binding, serine-type endopeptidase activity 447 Serum prothrombin conversion accelerator F7 9913 extracellular space, serine-type peptidase complex blood coagulation, positive regulation of leukocyte chemotaxis, positive regulation of platelet-derived growth factor receptor signaling pathway, positive regulation of positive chemotaxis, positive regulation of protein kinase B signaling, protein processing 3049594 17 24:40 VFLPQEQALSILHRPRR
PSQ01144 FD00536 Colicin-V P22522 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 15 None 103 Microcin-V bacteriocin cvaC 562 extracellular region cytolysis, defense response to bacterium 7952189, 8204625 15 1:15 MRTLTLNELDSVSGG
PSQ01145 FD00334 Protein Wnt-5a P22725 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 24 chemoattractant activity involved in axon guidance, cytokine activity, frizzled binding, protein domain specific binding, receptor tyrosine kinase-like orphan receptor binding, signaling receptor binding 380 None Wnt5a 10090 cell surface, cytoplasm, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space, glutamatergic synapse, postsynapse activation of GTPase activity, activation of JUN kinase activity, activation of MAPK activity, activation of protein kinase B activity, ameboidal-type cell migration, animal organ morphogenesis, anterior/posterior axis specification, embryo, anterior/posterior pattern specification, atrial septum development, axis elongation, axon guidance, axonal fasciculation, axonogenesis, canonical Wnt signaling pathway, cartilage development, cell fate commitment, cell migration, cell-cell signaling, cellular protein localization, cellular response to calcium ion, cellular response to interferon-gamma, cellular response to lipopolysaccharide, cellular response to molecule of bacterial origin, cellular response to transforming growth factor beta stimulus, cervix development, chemoattraction of serotonergic neuron axon, chemorepulsion of dopaminergic neuron axon, cochlea morphogenesis, convergent extension, convergent extension involved in axis elongation, convergent extension involved in organogenesis, determination of left/right symmetry, development of primary male sexual characteristics, digestive tract morphogenesis, dopaminergic neuron differentiation, embryonic digit morphogenesis, embryonic limb morphogenesis, embryonic skeletal system development, epithelial cell proliferation involved in mammary gland duct elongation, establishment of epithelial cell apical/basal polarity, establishment of planar polarity, face development, genitalia development, heart looping, hematopoietic stem cell proliferation, hindgut morphogenesis, hypophysis morphogenesis, inner ear morphogenesis, JNK cascade, keratinocyte differentiation, kidney development, lateral sprouting involved in mammary gland duct morphogenesis, limb morphogenesis, lung development, male gonad development, mammary gland branching involved in thelarche, melanocyte proliferation, mesenchymal-epithelial cell signaling, mesodermal to mesenchymal transition involved in gastrulation, midbrain development, midbrain dopaminergic neuron differentiation, midgut development, morphogenesis of an epithelium, negative chemotaxis, negative regulation of apoptotic process, negative regulation of axon extension involved in axon guidance, negative regulation of BMP signaling pathway, negative regulation of canonical Wnt signaling pathway, negative regulation of cell proliferation in midbrain, negative regulation of epithelial cell proliferation, negative regulation of fat cell differentiation, negative regulation of fibroblast growth factor receptor signaling pathway, negative regulation of melanin biosynthetic process, negative regulation of mesenchymal cell proliferation, negative regulation of prostatic bud formation, negative regulation of synapse assembly, negative regulation of transcription, DNA-templated, neural tube closure, neural tube development, neurogenesis, neuron differentiation, neuron projection morphogenesis, non-canonical Wnt signaling pathway, non-canonical Wnt signaling pathway via JNK cascade, notochord morphogenesis, olfactory bulb interneuron development, paraxial mesoderm formation, pericardium morphogenesis, planar cell polarity pathway involved in axis elongation, planar cell polarity pathway involved in axon guidance, planar cell polarity pathway involved in cardiac muscle tissue morphogenesis, planar cell polarity pathway involved in cardiac right atrium morphogenesis, planar cell polarity pathway involved in gastrula mediolateral intercalation, planar cell polarity pathway involved in neural tube closure, planar cell polarity pathway involved in outflow tract morphogenesis, planar cell polarity pathway involved in pericardium morphogenesis, planar cell polarity pathway involved in ventricular septum morphogenesis, positive regulation of angiogenesis, positive regulation of cartilage development, positive regulation of cell population proliferation, positive regulation of cell-cell adhesion, positive regulation of cell-cell adhesion mediated by cadherin, positive regulation of chemokine production, positive regulation of cytokine production, positive regulation of cytokine production involved in immune response, positive regulation of endocytosis, positive regulation of endothelial cell migration, positive regulation of endothelial cell proliferation, positive regulation of epithelial cell proliferation, positive regulation of fibroblast proliferation, positive regulation of gene expression, positive regulation of GTPase activity, positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-1 beta production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of JUN kinase activity, positive regulation of macrophage activation, positive regulation of macrophage cytokine production, positive regulation of meiotic nuclear division, positive regulation of mesenchymal cell proliferation, positive regulation of neuron death, positive regulation of neuron projection arborization, positive regulation of neuron projection development, positive regulation of NF-kappaB transcription factor activity, positive regulation of non-canonical Wnt signaling pathway, positive regulation of ossification, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of protein binding, positive regulation of protein catabolic process, positive regulation of protein kinase activity, positive regulation of protein kinase C activity, positive regulation of protein kinase C signaling, positive regulation of protein phosphorylation, positive regulation of response to cytokine stimulus, positive regulation of T cell chemotaxis, positive regulation of thymocyte apoptotic process, positive regulation of timing of anagen, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of tumor necrosis factor production, positive regulation of type I interferon-mediated signaling pathway, post-anal tail morphogenesis, primary heart field specification, primitive streak formation, protein phosphorylation, regulation of branching involved in mammary gland duct morphogenesis, regulation of cellular protein localization, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of postsynapse organization, regulation of postsynaptic cytosolic calcium ion concentration, regulation of protein localization, regulation of synapse organization, secondary heart field specification, secondary palate development, signal transduction, somite development, somitogenesis, tube closure, type B pancreatic cell development, urinary bladder development, uterus development, vagina development, ventricular septum development, Wnt signaling pathway, Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation, Wnt signaling pathway, calcium modulating pathway, Wnt signaling pathway, planar cell polarity pathway, wound healing 16602827 24 38:61 QVVIEANSWWSLGMNNPVQMSEVY
PSQ01146 FD00219 Hatching enzyme P22757 Eukaryota Metazoa Echinodermata Eleutherozoa Echinozoa Echinoidea Euechinoidea Echinacea Camarodonta Echinidea Echinidae Paracentrotus Paracentrotus lividus (Common sea urchin) 148 metalloendopeptidase activity, zinc ion binding 587 Envelysin, Sea-urchin-hatching proteinase None 7656 extracellular matrix None 2167841 148 19:166 VHNVPLPSTAPSIITQLSDITTSIIEEDAFGLTTPTTGLLTPVSENDSDDDGDDITTIQTTTSSSQTVISGVVVEEGVHESNVEILKAHLEKFGYTPPGSTFGEANLNYTSAILDFQEHGGINQTGILDADTAELLSTPRCGVPDVLP
PSQ01147 FD00012 P34 probable thiol protease P22895 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 99 cysteine-type endopeptidase activity 379 None None 3847 extracellular space, lysosome proteolysis involved in cellular protein catabolic process 2380191 99 24:122 RSILDLDLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMAN
PSQ01148 FD00242 Toxin coregulated pilin P23024 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae 25 None 224 Pilus colonization factor tcpA 666 extracellular organelle, integral component of membrane, pilus pathogenesis 2883655 25 1:25 MQLLKQLFKKKFVKEEHDKKTGQEG
PSQ01149 FD00010 Basic phospholipase A2 textilotoxin A chain P23026 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) 8 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 145 Phosphatidylcholine 2-acylhydrolase None 8673 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 3651474, 8431471 8 20:27 SDIPPLPL
PSQ01150 FND00332 Photosystem I reaction center subunit VIII P23079 Bacteria Cyanobacteria Nostocales Nostocaceae Trichormus Trichormus variabilis (strain ATCC 29413 11 None 46 None psaI 240292 integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane photosynthesis 1908790 11 1:11 MATAFLPSILA
Total Pages 43
Go to Lab Web Page