Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01123

ProSeqID PSQ01123
Family FD00125
Protein Name Brain-derived neurotrophic factor
UniProt ID P21237
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 112
Functions growth factor activity, nerve growth factor receptor binding, neurotrophin TRKB receptor binding
Preproprotein Length (aa) 249
Alt Name None
Gene Name Bdnf
NCBI ID 10090
Cellular Localization axon, cytoplasm, cytoplasmic vesicle, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, mitochondrial crista, mitochondrion, neuronal cell body, nuclear speck, perikaryon, perinuclear region of cytoplasm, postsynapse, secretory granule, synaptic vesicle, terminal bouton
Processes axon extension, axon guidance, axon target recognition, behavioral fear response, behavioral response to cocaine, circadian rhythm, collateral sprouting, dendrite development, dendrite extension, excitatory postsynaptic potential, fear response, feeding behavior, gamma-aminobutyric acid signaling pathway, glutamate secretion, inhibitory postsynaptic potential, inner ear development, learning, learning or memory, mechanoreceptor differentiation, memory, mitochondrial electron transport, NADH to ubiquinone, modulation of chemical synaptic transmission, negative regulation of apoptotic process, negative regulation of apoptotic signaling pathway, negative regulation of cell death, negative regulation of myotube differentiation, negative regulation of neuroblast proliferation, negative regulation of neuron apoptotic process, negative regulation of neuron death, negative regulation of striated muscle tissue development, negative regulation of synaptic transmission, GABAergic, nerve development, nerve growth factor signaling pathway, nervous system development, neuron projection extension, neuron projection morphogenesis, neuron recognition, peripheral nervous system development, positive regulation of collateral sprouting, positive regulation of DNA-binding transcription factor activity, positive regulation of glucocorticoid receptor signaling pathway, positive regulation of long-term neuronal synaptic plasticity, positive regulation of neuron differentiation, positive regulation of neuron projection development, positive regulation of peptidyl-serine phosphorylation, positive regulation of receptor binding, positive regulation of synapse assembly, regeneration, regulation of axon extension, regulation of collateral sprouting, regulation of long-term neuronal synaptic plasticity, regulation of metabolic process, regulation of neuron apoptotic process, regulation of neuron differentiation, regulation of retinal cell programmed cell death, regulation of short-term neuronal synaptic plasticity, regulation of synaptic plasticity, response to drug, retrograde trans-synaptic signaling by neuropeptide, modulating synaptic transmission, synapse assembly, taste bud development, transmembrane receptor protein tyrosine kinase signaling pathway, ureteric bud development
PubMed 7957235
Total Prosequence Length (aa) 112
Prosequence Location 19:130
Prosequence Sequence APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR
Preproprotein Sequence MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR