Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01140

ProSeqID PSQ01140
Family FD00454
Protein Name Endothelin-1
UniProt ID P22388
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 25
Functions cytokine activity, endothelin A receptor binding, endothelin B receptor binding, hormone activity, signaling receptor binding
Preproprotein Length (aa) 202
Alt Name Preproendothelin-1
Gene Name Edn1
NCBI ID 10116
Cellular Localization basal part of cell, cytoplasm, extracellular space, rough endoplasmic reticulum lumen, Weibel-Palade body
Processes adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway, artery smooth muscle contraction, blood vessel morphogenesis, body fluid secretion, branching involved in blood vessel morphogenesis, calcium-mediated signaling, cartilage development, cell surface receptor signaling pathway, cell-cell signaling, cellular calcium ion homeostasis, cellular response to calcium ion, cellular response to drug, cellular response to fatty acid, cellular response to glucocorticoid stimulus, cellular response to hypoxia, cellular response to interferon-gamma, cellular response to interleukin-1, cellular response to mineralocorticoid stimulus, cellular response to peptide hormone stimulus, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, dorsal/ventral pattern formation, endothelin receptor signaling pathway, epithelial fluid transport, G protein-coupled receptor signaling pathway, heart development, histamine secretion, in utero embryonic development, inositol phosphate-mediated signaling, intracellular signal transduction, maternal process involved in parturition, membrane depolarization, middle ear morphogenesis, multicellular organism aging, negative regulation of cellular protein metabolic process, negative regulation of gene expression, negative regulation of hormone secretion, negative regulation of nitric-oxide synthase biosynthetic process, negative regulation of smooth muscle cell apoptotic process, negative regulation of transcription by RNA polymerase II, neural crest cell development, nitric oxide transport, peptide hormone secretion, phosphatidylinositol 3-kinase signaling, phospholipase D-activating G protein-coupled receptor signaling pathway, positive regulation of cardiac muscle hypertrophy, positive regulation of cell growth involved in cardiac muscle cell development, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of cell size, positive regulation of chemokine-mediated signaling pathway, positive regulation of cytosolic calcium ion concentration, positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway, positive regulation of DNA-binding transcription factor activity, positive regulation of heart rate, positive regulation of hormone secretion, positive regulation of JUN kinase activity, positive regulation of MAP kinase activity, positive regulation of mitotic nuclear division, positive regulation of neutrophil chemotaxis, positive regulation of NIK/NF-kappaB signaling, positive regulation of odontogenesis, positive regulation of prostaglandin secretion, positive regulation of prostaglandin-endoperoxide synthase activity, positive regulation of renal sodium excretion, positive regulation of sarcomere organization, positive regulation of signaling receptor activity, positive regulation of smooth muscle cell proliferation, positive regulation of smooth muscle contraction, positive regulation of transcription by RNA polymerase II, positive regulation of urine volume, positive regulation of vascular associated smooth muscle cell proliferation, prostaglandin biosynthetic process, protein kinase C deactivation, protein kinase C-activating G protein-coupled receptor signaling pathway, regulation of blood pressure, regulation of glucose transmembrane transport, regulation of pH, regulation of sensory perception of pain, regulation of systemic arterial blood pressure by endothelin, regulation of vasoconstriction, respiratory gaseous exchange by respiratory system, response to activity, response to amino acid, response to dexamethasone, response to drug, response to hypoxia, response to leptin, response to lipopolysaccharide, response to muscle stretch, response to nicotine, response to ozone, response to prostaglandin F, response to salt, response to testosterone, response to transforming growth factor beta, rhythmic excitation, sensory perception of pain, skeletal system development, superoxide anion generation, vasoconstriction, vein smooth muscle contraction
PubMed 26479776
Total Prosequence Length (aa) 25
Prosequence Location 26:50
Prosequence Sequence AELSPRAEKEVQSPPPSTSWRPRRS
Preproprotein Sequence MDYFPVIFSLLFVAFQGAPETAVLGAELSPRAEKEVQSPPPSTSWRPRRSKRCSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRSKRSLKDLLPTKTTDQGNRCQCAHQKDKKCWNFCQADKELRAQSTMQKGVKDFKKGKPCPKLGKKCIYQQLVEGRKLRRLEAISNSIKTSFRVAKLKAELYRDQKLIHNRAH