Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01150

ProSeqID PSQ01150
Family FND00332
Protein Name Photosystem I reaction center subunit VIII
UniProt ID P23079
Taxonomy Bacteria-Cyanobacteria-Nostocales-Nostocaceae-Trichormus
Organisms Trichormus variabilis (strain ATCC 29413
Prosequence Length (aa) 11
Functions None
Preproprotein Length (aa) 46
Alt Name None
Gene Name psaI
NCBI ID 240292
Cellular Localization integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane
Processes photosynthesis
PubMed 1908790
Total Prosequence Length (aa) 11
Prosequence Location 1:11
Prosequence Sequence MATAFLPSILA
Preproprotein Sequence MATAFLPSILADASFLSSIFVPVIGWVVPIATFSFLFLYIEGEDVA