Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01151 FD00028 Albumin-8 P23110 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Helianthus Helianthus annuus (Common sunflower) 13 nutrient reservoir activity 141 Methionine-rich 2S protein, SFA8 None 4232 None None 1997318, 8915004 13 26:38 STTTIITTIIEEN
PSQ01152 FD00358 Photosystem I reaction center subunit PsaK P23317 Bacteria Cyanobacteria Nostocales Nostocaceae Trichormus Trichormus variabilis (strain ATCC 29413 8 None 86 Light-harvesting 6, Photosystem I subunit X psaK 240292 integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane photosynthesis 1908790 8 1:8 MLTSTLLA
PSQ01153 FD00125 Brain-derived neurotrophic factor P23560 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 110 growth factor activity, nerve growth factor receptor binding 247 Abrineurin BDNF 9606 axon, cytoplasm, dendrite, extracellular region, extracellular space, mitochondrion, nuclear speck, perinuclear region of cytoplasm, synaptic vesicle activation of phospholipase C activity, axon guidance, brain-derived neurotrophic factor receptor signaling pathway, collateral sprouting, memory, modulation of chemical synaptic transmission, negative regulation of apoptotic signaling pathway, negative regulation of myotube differentiation, negative regulation of neuron apoptotic process, nerve development, nerve growth factor signaling pathway, nervous system development, neuron projection morphogenesis, neurotrophin TRK receptor signaling pathway, peripheral nervous system development, positive regulation of brain-derived neurotrophic factor receptor signaling pathway, positive regulation of collateral sprouting, positive regulation of neuron projection development, positive regulation of non-membrane spanning protein tyrosine kinase activity, positive regulation of peptidyl-serine phosphorylation, positive regulation of receptor binding, positive regulation of synapse assembly, regulation of neuron differentiation, regulation of protein localization to cell surface, synapse assembly, transmembrane receptor protein tyrosine kinase signaling pathway 8527932 110 19:128 APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR
PSQ01154 FD00207 Glucan 1 P23776 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 21 beta-glucosidase activity, glucan exo-1,3-beta-glucosidase activity 448 Exo-1, Soluble cell wall protein 6 EXG1 559292 cell surface, extracellular region, fungal-type cell wall, fungal-type vacuole cellular glucan metabolic process, fungal-type cell wall organization, glucan catabolic process 1900250, 2125957, 8488724, 9748433 21 20:40 TPVPARDPSSIQFVHEENKKR
PSQ01155 FND00304 Bacteriocin lactacin-F subunit LafA P24022 Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus Lactobacillus johnsonii (strain CNCM I-12250 18 None 75 None lafA 257314 None cytolysis, defense response to bacterium 1903624 18 1:18 MKQFNYLSHKDLAVVVGG
PSQ01156 FD00003 Gamma-conotoxin-like TxVIIA P24160 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus textile (Cloth-of-gold cone) 27 ion channel inhibitor activity, toxin activity 76 TxIIA None 6494 extracellular region pathogenesis 1761058 27 20:46 MFQGDGEKSRKAEINFSETRKLARNKQ
PSQ01157 FND00024 Dermaseptin-S1 P24302 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 79 Dermaseptin , Dermaseptin I , Dermaseptin-1 None 8395 extracellular region defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism, regulation of defense response to virus 1909573, 8306981 23 23:45 EEEKRENEDEEKQEDDEQSEMKR
PSQ01158 FD00257 Aspergillopepsin-2 P24665 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati Aspergillus niger 41, 11 aspartic-type endopeptidase activity 282 Acid protease A, Aspergillopepsin II, Proctase A None 5061 None None 1918059;1918059 52 19:59, 99:109 APLTEKRRARKEARAAGKRHSNPPYIPGSDKEILKLNGTTN, GGGYGYWKNKR
PSQ01159 FD00400 Trypsin inhibitor P24924 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Caesalpinioideae mimosoid clade Acacieae Acacia Acacia confusa (Formosa acacia) 133 serine-type endopeptidase inhibitor activity 180 None ACTI 3809 None None 1794977 133 137:269 SDDESCKDLGISIDDENNRRLVVKDGHPLAVRFEKAHRSG
PSQ01160 FD00017 Coagulation factor X P25155 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 20, 55 calcium ion binding, serine-type endopeptidase activity 480 Stuart factor, Virus-activating protease F10 9031 extracellular space blood coagulation 2174359;2174359 75 21:40, 186:240 EGGVFIKKESADKFLERTKR, SVILPTNSNTNATSDQDVPSTNGSILEEVFTTTTESPTPPPRNGSSITDPNVDTR
PSQ01161 FD00474 Lysozyme M1 P25310 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces globisporus 193 lysozyme activity 300 1 acm 1908 extracellular region cell wall macromolecule catabolic process, cytolysis, defense response to bacterium, peptidoglycan catabolic process 2341041 193 77:269 ADTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGG
PSQ01162 FD00083 Cathepsin S P25326 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 98 collagen binding, cysteine-type endopeptidase activity, fibronectin binding, laminin binding, proteoglycan binding 331 None CTSS 9913 extracellular space, late endosome, lysosome, phagocytic vesicle adaptive immune response, antigen processing and presentation of exogenous peptide antigen via MHC class II, basement membrane disassembly, cellular response to thyroid hormone stimulus, collagen catabolic process, immune response, positive regulation of cation channel activity, protein processing, proteolysis involved in cellular protein catabolic process, response to acidic pH 1515067, 1864368, 2044774 98 17:114 HVHRDPTLDHHWDLWKKTYGKQYKEKNEEVARRLIWEKNLKTVTLHNLEHSMGMHSYELGMNHLGDMTSEEVISLMSSLRVPSQWPRNVTYKSDPNQK
PSQ01163 FD00147 Oryzain alpha chain P25776 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa Oryza sativa subsp 107 cysteine-type endopeptidase activity 458 None None 39947 extracellular space, lysosome proteolysis involved in cellular protein catabolic process 1885617 107 22:128 DMSIVSYGERSEEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNEA
PSQ01164 FD00489 Cruzipain P25779 Eukaryota Discoba Euglenozoa Kinetoplastea Metakinetoplastina Trypanosomatida Trypanosomatidae Trypanosoma Schizotrypanum Trypanosoma cruzi 104 cysteine-type endopeptidase activity 467 Cruzaine, Major cysteine proteinase None 5693 None None 2651912 104 19:122 CLVPAATASLHAEETLTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATFGVTPFSDLTREEFRSRYHNGAAHFAAAQERARVPVKVEVVG
PSQ01165 FD00106 Endopolygalacturonase II P26214 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati Aspergillus niger (strain ATCC 1015 , NCTC 3858a 6 polygalacturonase activity 362 Pectinase 2, Polygalacturonase II, Polygalacturonase X2 pgaII 380704 extracellular region carbohydrate metabolic process, cell wall organization 2226842 6 22:27 SPIEAR
PSQ01166 FD00167 Prosaposin P26779 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 36, 14 None 525 Proactivator polypeptide PSAP 9913 extracellular region, extracellular space, late endosome, lysosome adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway, epithelial cell differentiation involved in prostate gland development, lysosomal transport, prostate gland growth, regulation of lipid metabolic process, sphingolipid metabolic process 1554743;1554743 50 276:311, 392:405 KEMPMKTLVPAEVVSENVIPALGLVEPIKKDPAPAK, RGLPAATVRVMPRK
PSQ01167 FND00147 Mating pheromone Er-2 P26886 Eukaryota Sar Alveolata Ciliophora Intramacronucleata Spirotrichea Hypotrichia Euplotida Euplotidae Euplotes Euplotes raikovi 16 mating pheromone activity 75 Euplomone R2 MAT2, MAT9 5938 extracellular region None 1549567 16 20:35 FRLQSRLRSNMEASAR
PSQ01168 FD00486 Auracyanin-B P27197 Bacteria Chloroflexi Chloroflexia Chloroflexales Chloroflexineae Chloroflexaceae Chloroflexus Chloroflexus aurantiacus (strain ATCC 29366 24 copper ion binding, electron transfer activity, oxidoreductase activity 240 None None 324602 plasma membrane photosynthetic electron transport chain 1313011 24 57:80 TAGGFVAATPRPTATPRPTAAPAP
PSQ01169 FD00389 Capsid protein P27406 Viruses Riboviria Orthornavirae Pisuviricota Pisoniviricetes Picornavirales Caliciviridae Vesivirus Feline calicivirus (strain F9) (FCV) 124 None 671 Coat protein, VP1 CPP76 11981 host cell cytoplasm, T None 1731695 124 1:124 MCSTCANVLKYYDWDPHFKLVINPNNFLSVGFCSNPLMCCYPELLPEFGTVWDCDRSPLEIYLESILGDDEWASTFDAVDPVVPPMHWGAAGKIFQPHPGVLMHHLIGKVAAGWDPDLPLIRLE
PSQ01170 FD00004 Tryptase P27435 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 10 identical protein binding, peptidase activity, serine-type endopeptidase activity 273 Mast cell protease 7, Tryptase alpha, Tryptase Tpsab1 10116 extracellular space, mast cell granule extracellular matrix disassembly, proteolysis 1314562, 2036367 10 19:28 APSLAMPREG
PSQ01171 FD00304 Beta-lytic metalloendopeptidase P27458 Bacteria Proteobacteria Betaproteobacteria Burkholderiales Alcaligenaceae Achromobacter Achromobacter lyticus 171 metal ion binding, metalloendopeptidase activity 374 Beta-lytic protease None 224 extracellular region None 2228973 171 25:195 ARRATAQRRGSGVFYDEMFDFDIDAHLAKHAPHLHKHSEEISHWAGYSGISRSVDRADGAAERAVTPSARRIVRSASWRAPTASARRPARSRWRCASRCTSAIPTRQGAGDAGPRQSAAGAVRAFRRQRAGGRAARRRRVPAGLRPPVQRTAPGQGGFGPLRQGRPGRAAV
PSQ01172 FD00116 Flagellin B1 P27803 Archaea Euryarchaeota Methanomada group Methanococci Methanococcales Methanococcaceae Methanococcus Methanococcus voltae 12 structural molecule activity 218 None flaB1 2188 archaeal-type flagellum archaeal or bacterial-type flagellum-dependent cell motility 2106880 12 1:12 MNIKEFLSNKKG
PSQ01173 FD00116 Flagellin B2 P27804 Archaea Euryarchaeota Methanomada group Methanococci Methanococcales Methanococcaceae Methanococcus Methanococcus voltae 12 structural molecule activity 216 None flaB2 2188 archaeal-type flagellum archaeal or bacterial-type flagellum-dependent cell motility 2106880 12 1:12 MKIKEFMSNKKG
PSQ01174 FD00494 Acyloxyacyl hydrolase P28039 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 acyloxyacyl hydrolase activity, calcium ion binding 575 None AOAH 9606 cytoplasmic vesicle, extracellular region, intracellular membrane-bounded organelle fatty acid metabolic process, lipopolysaccharide catabolic process, negative regulation of inflammatory response 1883828 11 24:34 SPANDDQSRPS
PSQ01175 FD00154 Proteasome subunit beta P28061 Archaea Euryarchaeota Diaforarchaea group Thermoplasmata Thermoplasmatales Thermoplasmataceae Thermoplasma Thermoplasma acidophilum (strain ATCC 25905 , 15155 8 endopeptidase activity, threonine-type endopeptidase activity 211 20S proteasome beta subunit , Proteasome core protein PsmB psmB 273075 cytoplasm, proteasome core complex, beta-subunit complex proteasomal protein catabolic process 8999862 8 1:8 MNQTLETG
PSQ01176 FD00142 Proteasome subunit beta type-4 P28070 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 45 endopeptidase activity, lipopolysaccharide binding, threonine-type endopeptidase activity 264 26 kDa prosomal protein, Macropain beta chain, Multicatalytic endopeptidase complex beta chain, Proteasome beta chain, Proteasome chain 3 PSMB4 9606 ciliary basal body, cytoplasm, cytosol, extracellular exosome, mitochondrion, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, negative regulation of inflammatory response to antigenic stimulus, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 2306472 45 1:45 MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITR
PSQ01177 FD00068 Proteasome subunit beta type-6 P28072 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 33 cadherin binding, endopeptidase activity, threonine-type endopeptidase activity 240 Macropain delta chain, Multicatalytic endopeptidase complex delta chain, Proteasome delta chain, Proteasome subunit Y PSMB6 9606 cytoplasm, cytosol, extracellular exosome, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 1888762, 2306472 33 2:34 AATLLAARGAGPAPAWGPEAFTPDWESREVSTG
PSQ01178 FD00068 Proteasome subunit beta type-6 P28073 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 32 endopeptidase activity, threonine-type endopeptidase activity 240 Macropain delta chain, Multicatalytic endopeptidase complex delta chain, Proteasome chain 5, Proteasome delta chain, Proteasome subunit Y Psmb6 10116 cytoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process 2335214 32 2:33 AAALAVRGAVSAPAFGPEALTPDWENREVSTG
PSQ01179 FD00101 Proteasome subunit beta type-5 P28074 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 59 endopeptidase activity, peptidase activity, threonine-type endopeptidase activity 263 Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit MB1, Proteasome subunit X PSMB5 9606 centrosome, cytoplasm, cytosol, extracellular exosome, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, proteolysis, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, response to oxidative stress, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway 2306472 59 1:59 MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHG
PSQ01180 FD00101 Proteasome subunit beta type-5 P28075 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 59 endopeptidase activity, peptidase activity, threonine-type endopeptidase activity 263 Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit X Psmb5 10116 cytoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, proteolysis, response to oxidative stress 2335214 59 1:59 MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHG
PSQ01181 FD00068 Proteasome subunit beta type-9 P28077 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 20 endopeptidase activity, proteasome binding, threonine-type endopeptidase activity 219 Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, Proteasome chain 7, Proteasome subunit beta-1i, Really interesting new gene 12 protein Psmb9 10116 cytoplasm, cytosol, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex, spermatoproteasome complex antigen processing and presentation, cellular response to electrical stimulus, cellular response to interleukin-1, cellular response to virus, liver development, muscle atrophy, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, regulation of cysteine-type endopeptidase activity, response to alkaloid, response to bacterium, response to benzene, response to drug, spleen development, thymus development 2335214 20 1:20 MLQAGAPTAGSFRTGEVHTG
PSQ01182 FD00011 Alkaline protease 1 P28296 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Fumigati Neosartorya fumigata (strain ATCC MYA-4609 , A1100) (Aspergillus fumigatus) 80 fibrinogen binding, IgE binding, peptidase activity, serine-type endopeptidase activity, serine-type peptidase activity 403 Aspergillopeptidase B, Aspergillus proteinase B, Elastase, Elastinolytic serine proteinase, Oryzin alp1 330879 extracellular region, extracellular space complement activation, elastin catabolic process, evasion of host immune response via regulation of host complement system, pathogenesis, protein catabolic process 10677362 80 22:101 PVQETRRAAQKIPGKYIVTFKPGTDTATIESHTLWATDLHKRNLERRDTTSGEPPVGIEKSYKIKDFAAYAGSFDDATIE
PSQ01183 FD00016 Alpha-defensin 2 P28309 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 39 None 93 Cryptdin-1, Defensin-related cryptdin-2 Defa2 10090 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, membrane disruption in other organism, response to drug 1500163, 1500431 39 20:58 DPIQNTDEETKTEEQSGEEDQAVSVSFGDREGASLQEES
PSQ01184 FD00016 Alpha-defensin 3 P28310 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 42 None 93 Defensin-related cryptdin-3 Defa3 10090 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, membrane disruption in other organism, response to drug 1500431 42 17:58 VQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEES
PSQ01185 FD00016 Alpha-defensin 5 P28312 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 39 None 93 Defensin-related cryptdin-5 Defa5 10090 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, membrane disruption in other organism 1500431 39 20:58 DPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEEL
PSQ01186 FD00150 Ribosome-inactivating protein P28522 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Tripsacinae Zea Zea mays (Maize) 25 rRNA N-glycosylase activity, toxin activity 301 rRNA N-glycosidase None 4577 None defense response, negative regulation of translation 1744135 25 162:186 MATLEEEEVKMQMQMPEAADLAAAA
PSQ01187 FD00072 Photosystem II reaction center protein K P28642 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) 24 None 46 None psbK 3888 chloroplast thylakoid membrane, integral component of membrane, photosystem II reaction center photosynthesis 8262226, 9632665 24 1:24 MLNIFSLVCICINSALYSSSFFLG
PSQ01188 FD00414 Gingipain R1 P28784 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 203 calcium ion binding, calcium-dependent cysteine-type endopeptidase activity 991 Arg-gingipain, Gingipain 1, RGP-1 rgpA 837 extracellular region pathogenesis, proteolysis 1527017, 7864651 203 25:227 QTELGRNPNVRLLESTQQSVTKVQFRMDNLKFTEVQTPKGMAQVPTYTEGVNLSEKGMPTLPILSRSLAVSDTREMKVEVVSSKFIEKKNVLIAPSKGMIMRNEDPKKIPYVYGKSYSQNKFFPGEIATLDDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEITVAVSETSEQGKNILNKKGTFAGFEDTYKRMFMNYEPGR
PSQ01189 FD00118 Alpha-2-antiplasmin P28800 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 18 protease binding, protein homodimerization activity, serine-type endopeptidase inhibitor activity 492 Alpha-2-plasmin inhibitor, Serpin F2 SERPINF2 9913 cell surface, extracellular space, fibrinogen complex acute-phase response, blood vessel morphogenesis, collagen fibril organization, maintenance of blood vessel diameter homeostasis by renin-angiotensin, negative regulation of endopeptidase activity, negative regulation of fibrinolysis, negative regulation of plasminogen activation, positive regulation of cell differentiation, positive regulation of collagen biosynthetic process, positive regulation of ERK1 and ERK2 cascade, positive regulation of JNK cascade, positive regulation of smooth muscle cell proliferation, positive regulation of stress fiber assembly, positive regulation of transcription by RNA polymerase II, positive regulation of transforming growth factor beta production 1385210 18 23:40 FSPVSTMEPLDLQLMDGQ
PSQ01190 FD00375 Meprin A subunit alpha P28825 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 44 metalloendopeptidase activity, zinc ion binding 747 Endopeptidase-2, MEP-1 Mep1a 10090 membrane, meprin A complex None 1374387, 1894622, 8615815 44 21:64 VSIKHLLNGSDHDTDVGEQKDIFEINLAAGLNLFQGDILLPRTR
PSQ01191 FD00006 Alpha-conotoxin SII P28879 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus striatus (Striated cone) 29 acetylcholine receptor inhibitor activity, toxin activity 72 None None 6493 extracellular region, host cell postsynaptic membrane pathogenesis 1390774 29 22:50 FPSDRASDGRDDEAKDERSDMHESDRNGR
PSQ01192 FD00080 Guanylin P28902 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 77 guanylate cyclase activator activity, guanylate cyclase regulator activity 120 Guanylate cyclase activator 2A Guca2a 10116 extracellular region None 1346555 77 24:100 VQDGDLSFPLESVKQLKHLREVQEPTLMSHKKFALRLPKPVAPELCSQSAFPEALRPLCEKPNAEEILQRLEAIAQD
PSQ01193 FD00388 Carboxypeptidase T P29068 Bacteria Firmicutes Bacilli Bacillales Thermoactinomycetaceae Thermoactinomyces Thermoactinomyces vulgaris 75 metallocarboxypeptidase activity, zinc ion binding 424 None cpt 2026 None None 6424730 75 24:98 FSQNIENPSIFDLGIKLYKIDGVSTKEQRSAIASTGAAIEEVGKDYVKVLATPSEAKQIKQKGFTATVDTSLTTQ
PSQ01194 FD00152 Proprotein convertase subtilisin P29122 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 86 endopeptidase activity, heparin binding, nerve growth factor binding, serine-type endopeptidase activity 969 Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin PCSK6 9606 cell surface, collagen-containing extracellular matrix, endoplasmic reticulum, extracellular region, extracellular space, Golgi lumen, membrane, plasma membrane cornification, glycoprotein metabolic process, nerve growth factor processing, nerve growth factor production, peptide hormone processing, protein processing, regulation of BMP signaling pathway, regulation of lipoprotein lipase activity, secretion by cell 9738469 86 64:149 PPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR
PSQ01195 FD00478 Metalloendoproteinase 1 P29136 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen Soja Glycine max (Soybean) (Glycine hispida) 105 metalloendopeptidase activity, zinc ion binding 305 SMEP1 None 3847 extracellular matrix collagen catabolic process, extracellular matrix organization 16668986 105 29:133 HGPYAWDGEATYKFTTYHPGQNYKGLSNVKNYFHHLGYIPNAPHFDDNFDDTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTPRCGVPDIIINTNKTTSFGMISD
PSQ01196 FD00248 Minor extracellular protease vpr P29141 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 132 serine-type endopeptidase activity 806 None vpr 224308 extracellular region None 10658653, 1938892 132 29:160 APASSKTSADLEKAEVFGDIDMTTSKKTTVIVELKEKSLAEAKEAGESQSKSKLKTARTKAKNKAIKAVKNGKVNREYEQVFSGFSMKLPANEIPKLLAVKDVKAVYPNVTYKTDNMKDKDVTISEDAVSPQ
PSQ01197 FD00049 Bacillolysin P29148 Bacteria Firmicutes Bacilli Bacillales Paenibacillaceae Paenibacillus Paenibacillus polymyxa (Bacillus polymyxa) 262 metal ion binding, metalloendopeptidase activity 590 Neutral protease npr 1406 extracellular region None 1834632 262 25:286 ESSVSGPAQLTPTFHTEQWKAPSSVSGDDIVWSYLNRQKKSLLGVDSSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVTSYLGAVINEDQQEEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDAEEPSSVSKDTYAEAANNDKTLSVDKDELSLDKASVLKDSKIEAVEAEKSSIAKIANLQPEVDPKAELYYYPKGDDLLLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDII
PSQ01198 FD00146 Delta-ctenitoxin-Pn2a P29425 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 17 toxin activity 82 Delta-CNTX-Pn1c , Neurotoxin Tx2-6 None 6918 extracellular region None 1397265, 16278100, 19231838 17 18:34 ESIEESRDDFAVEELGR
PSQ01199 FD00074 Bacteriocin pediocin PA-1 P29430 Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Pediococcus Pediococcus acidilactici group Pediococcus acidilactici 18 None 62 Pediocin ACH pedA 1254 extracellular region cytolysis, defense response to bacterium 1402795, 1575516 18 1:18 MKKIEKLTEKEMANIIGG
PSQ01200 FD00207 Glucan 1 P29717 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida albicans (strain SC5314 17 beta-glucosidase activity, cell adhesion molecule binding, glucan exo-1,3-beta-glucosidase activity, transferase activity 438 Exo-1 XOG1 237561 cell surface, cell wall, extracellular region, extracellular vesicle cell-substrate adhesion, cellular glucan metabolic process, fungal-type cell wall organization, glucan catabolic process, pathogenesis, single-species biofilm formation in or on host organism, single-species biofilm formation on inanimate substrate 1789004, 8436950 17 22:38 SVISNPFKPNGNLKFKR
Total Pages 43
Go to Lab Web Page