Details of PSQ01118
| ProSeqID |
PSQ01118 |
| Family |
FD00170 |
| Protein Name |
Proteasome subunit beta type-1 |
| UniProt ID |
P20618
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
28 |
| Functions |
endopeptidase activity, threonine-type endopeptidase activity |
| Preproprotein Length (aa) |
241 |
| Alt Name |
Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome component C5, Proteasome gamma chain |
| Gene Name |
PSMB1 |
| NCBI ID |
9606 |
| Cellular Localization |
cytoplasm, cytosol, extracellular exosome, extracellular region, ficolin-1-rich granule lumen, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex, secretory granule lumen |
| Processes |
anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, neutrophil degranulation, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway |
| PubMed |
2306472
|
| Total Prosequence Length (aa) |
28 |
| Prosequence Location |
1:28 |
| Prosequence Sequence |
MLSSTAMYSAPGRDLGMEPHRAAGPLQL |
| Preproprotein Sequence |
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD |
