Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01251 FD00511 Pre-protein VI P35988 Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus A Human adenovirus A serotype 12 (HAdV-12) (Human adenovirus 12) 33 None 265 None L3 28282 host cell cytoplasm, host cell nucleus, viral capsid, viral procapsid lysis of host organelle involved in viral entry into host cell, microtubule-dependent intracellular transport of viral material towards nucleus, viral release from host cell 8438575 33 1:33 MEDINFSSLAPRHGTRPYMGTWNEIGTSQLNGG
PSQ01252 FD00572 NADH-cytochrome b5 reductase 2 P36060 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 41 cytochrome-b5 reductase activity, acting on NAD(P)H, NADH dehydrogenase activity 302 Mitochondrial cytochrome b reductase, p34 MCR1 559292 integral component of mitochondrial outer membrane, mitochondrial intermembrane space, mitochondrial outer membrane, mitochondrion cellular response to oxidative stress, ergosterol biosynthetic process 8001120, 9866716 41 1:41 MFSRLSRSHSKALPIALGTVAIAAATAFYFANRNQHSFVFN
PSQ01253 FD00007 Chymotrypsin BII P36178 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Dendrobranchiata Penaeoidea Penaeidae Penaeus Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) 30 serine-type endopeptidase activity 271 None None 6689 extracellular space collagen catabolic process 1458841 30 16:45 SGNPAAGKPWHWKSPKPLVDPRIHVNATPR
PSQ01254 FD00012 Cysteine proteinase ACP1 P36184 Eukaryota Amoebozoa Evosea Archamoebae Mastigamoebida Entamoebidae Entamoeba Entamoeba histolytica 79 cysteine-type peptidase activity 308 None ACP1 5759 extracellular space None 8473498 79 14:92 NEVAFKQWAATHNKVFANRAEYLYRFAVFLDNKKFVEANANTELNVFADMTHEEFIQTHLGMTYEVPETTSNVKAAVKA
PSQ01255 FD00012 Cysteine proteinase ACP2 P36185 Eukaryota Amoebozoa Evosea Archamoebae Mastigamoebida Entamoebidae Entamoeba Entamoeba histolytica 181 cysteine-type peptidase activity 310 None ACP2 5759 extracellular space None 8473498 181 89:269 QAPESVDWRKEGKVTPLRDQAQCGSCYTFGSLAALEGRLLIEKGGDANTLDLSEEHMQCTRDNGNNGCNGGLGSNVYDYIIEHGVAKESDYPYTGSDSTCKTNVKSFRKITGYTKVPRNNEAELKAALSQGLLDVSIDVSSAKFQLYKSGAYTDTKCKNNYFALNHEVCAVGYGVVDGKEC
PSQ01256 FND00053 Ceratotoxin-A P36190 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Tephritoidea Tephritidae Ceratitis Ceratitis Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata) 12 None 71 None CTXA1 7213 extracellular region defense response to bacterium, hemolysis in other organism, innate immune response 8353519 12 24:35 EPAAEDSVVVKR
PSQ01257 FD00065 Endo-1 P36217 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Hypocreaceae Trichoderma Hypocrea jecorina (strain ATCC 56765 , (Trichoderma reesei) 14 endo-1,4-beta-xylanase activity 223 1, Alkaline endo-beta-1 xyn2 1344414 extracellular region xylan catabolic process 1369024 14 20:33 APAAEVESVAVEKR
PSQ01258 FD00065 Endo-1 P36218 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Hypocreaceae Trichoderma Hypocrea jecorina (strain ATCC 56765 , (Trichoderma reesei) 32 endo-1,4-beta-xylanase activity 229 1, Acidic endo-beta-1 xyn1 1344414 extracellular region xylan catabolic process 1369024 32 20:51 MPTGLEPESSVNVTERGMYDFVLGAHNDHRRR
PSQ01259 FD00007 Glandular kallikrein-7 P36373 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 6 peptidase activity, serine-type endopeptidase activity 261 Esterase B, Kallikrein-related protein K1, Proteinase A, RSKG-7, Tissue kallikrein Klk7 10116 epidermal lamellar body, extracellular space, secretory granule positive regulation of antibacterial peptide production, regulation of systemic arterial blood pressure, zymogen activation 2194829, 3482210 6 19:24 PPGQSR
PSQ01260 FD00004 Glandular kallikrein-10 P36375 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 6 serine-type endopeptidase activity 259 Endopeptidase K, Proteinase B, T-kininogenase, Tissue kallikrein Klk10 10116 secretory granule regulation of systemic arterial blood pressure, zymogen activation 2026164, 2303430, 3482210 6 19:24 PPGQSR
PSQ01261 FD00036 Lantibiotic lacticin-481 P36499 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 24 signaling receptor binding 58 Lactococcin-DR lctA 1360 extracellular region cytolysis, defense response to bacterium 16348628 24 1:24 MKEQNSFNLLQEVTESELDLILGA
PSQ01262 FD00036 Lantibiotic salivaricin-A P36500 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus salivarius 26 signaling receptor binding 48 None salA 1304 extracellular region cytolysis, defense response to bacterium 8357242 26 1:26 MKNSKDILNNAIEEVSEKELMEVAGG
PSQ01263 FD00036 Lantibiotic streptococcin A-FF22 P36501 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus pyogenes 25 signaling receptor binding 58 Antibacterial peptide SA-FF22 scnA 1314 cell surface, extracellular region cytolysis, defense response to bacterium 8125103 25 1:25 MEKNNEVINSIQEVSLEELDQIIGA
PSQ01264 FND00366 Acid shock protein P36560 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 37 None 102 None asr 83333 periplasmic space response to zinc ion 12670971 37 22:58 AETTTTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQ
PSQ01265 FD00284 Prepilin peptidase-dependent protein D P36647 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 6 None 146 None ppdD 83333 integral component of membrane, type IV pilus type IV pilus biogenesis, type IV pilus-dependent motility 10633126 6 1:6 MDKQRG
PSQ01266 FD00476 Lon protease homolog P36775 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 61 ATP binding, ATP-dependent peptidase activity, sequence-specific DNA binding, serine-type endopeptidase activity, single-stranded DNA binding 1140 None PIM1 559292 mitochondrial matrix, mitochondrion cellular response to oxidative stress, chaperone-mediated protein complex assembly, mitochondrial DNA metabolic process, mitochondrial respiratory chain complex assembly, mitochondrion organization, oxidation-dependent protein catabolic process, protein folding, protein quality control for misfolded or incompletely synthesized proteins, regulation of mitochondrial DNA metabolic process, response to heat 9405361, 9724747 61 38:98 ASTLTVRDVENIKPSHIIKSPTWQEFQHQLKDPRYMEHFAQLDAQFARHFMATNSGKSILA
PSQ01267 FND00077 U1-plectoxin-Pt1a P36983 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Pholcoidea Plectreuridae Plectreurys Plectreurys tristis (Spider) (Plectreurys bispinosus) 13 ion channel inhibitor activity, toxin activity 82 PLT-V, Plectoxin V, Plectoxin-5 None 33319 extracellular region pathogenesis 8157635 13 21:33 EEQVNVPFLPDER
PSQ01268 FND00361 U1-plectoxin-Pt1b P36984 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Pholcoidea Plectreuridae Plectreurys Plectreurys tristis (Spider) (Plectreurys bispinosus) 13 ion channel inhibitor activity, signaling receptor binding, toxin activity 61 Plectoxin VIII, Plectoxin-8 None 33319 extracellular region pathogenesis 8157635 13 1:13 EEQVNVPFLPDER
PSQ01269 FND00077 U1-plectoxin-Pt1c P36985 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Pholcoidea Plectreuridae Plectreurys Plectreurys tristis (Spider) (Plectreurys bispinosus) 13 ion channel inhibitor activity, toxin activity 79 Plectoxin XI, Plectoxin-11 None 33319 extracellular region pathogenesis 8157635 13 19:31 EEQVNVPFLPDER
PSQ01270 FD00315 Lysosomal acid lipase P38571 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 49 lipase activity, sterol esterase activity 399 Cholesteryl esterase, Lipase A, Sterol esterase LIPA 9606 cytosol, fibrillar center, intracellular membrane-bounded organelle, lysosomal lumen, lysosome, nucleoplasm cell morphogenesis, cell population proliferation, homeostasis of number of cells within a tissue, inflammatory response, lipid catabolic process, low-density lipoprotein particle clearance, lung development, sterol metabolic process, tissue remodeling 15269241, 8112342 49 28:76 AVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDK
PSQ01271 FD00492 Bacteriocin carnobacteriocin BM1 P38579 Bacteria Firmicutes Bacilli Lactobacillales Carnobacteriaceae Carnobacterium Carnobacterium maltaromaticum (Carnobacterium piscicola) 18 None 61 None cbnBM1 2751 extracellular region cytolysis by symbiont of host cells, defense response to bacterium, positive regulation of killing of cells of other organism 8163526 18 1:18 MKSVKELNKKEMQQINGG
PSQ01272 FND00143 Bacteriocin carnobacteriocin B2 P38580 Bacteria Firmicutes Bacilli Lactobacillales Carnobacteriaceae Carnobacterium Carnobacterium maltaromaticum (Carnobacterium piscicola) 18 None 66 Carnocin CP52 cbnB2 2751 extracellular region cytolysis by symbiont of host cells, defense response to bacterium, positive regulation of killing of cells of other organism 8163526 18 1:18 MNSVKELNVKEMKQLHGG
PSQ01273 FND00127 Protein YGP1 P38616 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 18 None 360 GP38 YGP1 559292 extracellular region cell wall assembly 8139573 18 20:37 SPIENLFKYRAVKASHSK
PSQ01274 FD00449 Acetyl-CoA--deacetylcephalosporin C acetyltransferase P39058 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Hypocreales incertae sedis Acremonium Acremonium chrysogenum (Cephalosporium acremonium) 71 deacetylcephalosporin-C acetyltransferase activity 444 None CEFG 5044 None antibiotic biosynthetic process 1540196 71 1:71 MLPSAQVARLKPDPFPPSLSPIPHGAVTFAALAPCHNLPIFSSRQMLRDSLTYSHTSPTMSPQIANRFEAS
PSQ01275 FD00445 Dextranase P39652 Bacteria Actinobacteria Micrococcales Micrococcaceae Arthrobacter Arthrobacter sp 17 dextranase activity 640 Alpha-1, Endodextranase None 74565 extracellular region metabolic process 1859672 17 33:49 ATAPAAAPPGVPAALKA
PSQ01276 FD00007 Mite allergen Der p 3 P39675 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Acariformes Sarcoptiformes Astigmata Psoroptidia Analgoidea Pyroglyphidae Dermatophagoidinae Dermatophagoides Dermatophagoides pteronyssinus (European house dust mite) 11 serine-type endopeptidase activity 261 Allergen Der p III DERP3 6956 extracellular region None 1537598, 8012853 11 19:29 NPILPASPNAT
PSQ01277 FND00100 Killer toxin KHS P39690 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker 9 toxin activity 708 Killer of heat sensitive KHS1 4932 integral component of membrane, plasma membrane None 1368726 9 28:36 DRANTVTSN
PSQ01278 FD00335 Plasmepsin-1 P39898 Eukaryota Sar Alveolata Apicomplexa Aconoidasida Haemosporida Plasmodiidae Plasmodium Plasmodium (Laverania) Plasmodium falciparum 146 aspartic-type endopeptidase activity 452 Aspartic hemoglobinase I, PfAPG None 5833 vacuole None 2007860 146 124:269 NAGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQ
PSQ01279 FD00040 Neutral protease B P39899 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 195 metal ion binding, metalloendopeptidase activity 540 None nprB 224308 extracellular region None 1917867 195 29:223 EESIEYDHTYQTPSYIIEKSPQKPVQNTTQKESLFSYLDKHQTQFKLKGNANSHFRVSKTIKDPKTKQTFFKLTEVYKGIPIYGFEQAVAMKENKQVKSFFGKVHPQIKDVSVTPSISEKKAIHTARRELEASIGKIEYLDGEPKGELYIYPHDGEYDLAYLVRLSTSEPEPGYWHYFIDAKNGKVIESFNAIHE
PSQ01280 FD00048 Osteocalcin P40147 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 33 calcium ion binding 101 Bone Gla protein, Gamma-carboxyglutamic acid-containing protein bglap 8355 extracellular region biomineral tissue development, bone development, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin K 8567186 33 20:52 SKDADHSNSVGESHSSEAFISRQESASFARLKR
PSQ01281 FD00048 Osteocalcin P40148 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Spariformes Sparidae Sparus Sparus aurata (Gilthead sea bream) 34 calcium ion binding 97 Bone Gla protein, Gamma-carboxyglutamic acid-containing protein bglap 8175 extracellular region biomineral tissue development, bone development, regulation of cellular response to insulin stimulus, response to vitamin K 8567186 34 19:52 SDASTGSQPASDNPADEGMFVERDQASAVVRQKR
PSQ01282 FD00320 Interleukin-15 P40221 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Chlorocebus Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops) 19 cytokine activity, cytokine receptor binding 162 None IL15 9534 extracellular space immune response, interleukin-15-mediated signaling pathway, neutrophil activation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phagocytosis 8178155 19 30:48 GIHVFILGCFSAGLPKTEA
PSQ01283 FD00081 Brevinin-2Ef P40842 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Pelophylax Pelophylax lessonae (Pool frog) (Rana lessonae) 19 None 74 None None 45623 extracellular region defense response to bacterium, hemolysis in other organism 8163497 19 23:41 QEERNADDDDGEMTEEEKR
PSQ01284 FD00588 M-factor P40849 Eukaryota Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (strain 972 29 mating pheromone activity 41 None mfm3 284812 extracellular region, plasma membrane cell-cell signaling, positive regulation of pheromone response MAPK cascade, regulation of cell cycle switching, mitotic to meiotic cell cycle, signal transduction involved in positive regulation of conjugation with cellular fusion 1547790 29 1:29 MDSMANTVSSSVVNTGNKPSETLNKTVKN
PSQ01285 FD00053 Thermostable alkaline protease P41363 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Alkalihalobacillus Bacillus halodurans (strain ATCC BAA-125 , 69 metal ion binding, serine-type endopeptidase activity 361 None None 272558 extracellular region None 1370008 69 25:93 SEEKKEYLIVVEPEEVSAQSVEESYDVDVIHEFEEIPVIHAELTKKELKKLKKDPNVKAIEKNAEVTIS
PSQ01286 FD00538 Drosomycin P41964 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6 None 70 Cysteine-rich peptide Drs 7227 extracellular space antibacterial humoral response, antifungal humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, defense response, defense response to fungus, defense response to Gram-negative bacterium, defense response to protozoan, killing of cells of other organism, response to bacterium, response to wounding 7806546 6 21:26 ANEADA
PSQ01287 FD00075 Zona pellucida sperm-binding protein 3 P42098 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 89 acrosin binding, carbohydrate binding, receptor ligand activity, structural constituent of egg coat 421 Sperm receptor, Zona pellucida glycoprotein 3, Zona pellucida glycoprotein 3-beta, Zona pellucida protein C ZP3 9823 collagen-containing extracellular matrix, egg coat, extracellular matrix, extracellular space, integral component of membrane, plasma membrane binding of sperm to zona pellucida, blastocyst formation, egg coat formation, humoral immune response mediated by circulating immunoglobulin, negative regulation of binding of sperm to zona pellucida, negative regulation of transcription, DNA-templated, oocyte development, phosphatidylinositol-mediated signaling, positive regulation of acrosomal vesicle exocytosis, positive regulation of acrosome reaction, positive regulation of antral ovarian follicle growth, positive regulation of humoral immune response, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-4 production, positive regulation of leukocyte migration, positive regulation of ovarian follicle development, positive regulation of T cell proliferation, positive regulation of transcription, DNA-templated, positive regulation of type IV hypersensitivity 8562067 89 333:421 RKLSMPKRQSAPRSRRHVTDEADVTVGPLIFLGKTSDHGVEGSTSSPTSVMVGLGLATVVTLTLATIVLGVPRRRRAAAHLVCPVSASQ
PSQ01288 FND00087 FMRFamide-related neuropeptides P42565 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Heterobranchia Euthyneura Panpulmonata Hygrophila Lymnaeoidea Lymnaeidae Lymnaea Lymnaea stagnalis (Great pond snail) (Helix stagnalis) 71 None 360 None None 6523 extracellular region neuropeptide signaling pathway 1421117 71 205:275 KQQVATDDSGELDDEILSRVSDDDKNIRRKRSTDSAENAHTRHEREASAPRAKGKVGEVKSSDDFQSREIR
PSQ01289 FD00558 Cell death protein 3 P42573 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 221 cysteine-type endopeptidase activator activity involved in apoptotic process, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, identical protein binding 503 Caspase ced-3 ced-3 6239 caspase complex, cytoplasm, membrane, mitochondrion, neuronal cell body, nuclear membrane, perikaryon, perinuclear region of cytoplasm, presynapse actin filament depolymerization, activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, apoptotic process involved in development, defense response to Gram-negative bacterium, embryo development ending in birth or egg hatching, execution phase of apoptosis, muscle cell cellular homeostasis, negative regulation of cellular response to manganese ion, positive regulation of apoptotic process involved in development, positive regulation of cellular response to gamma radiation, positive regulation of neuron apoptotic process, positive regulation of oviposition, positive regulation of protein processing, positive regulation of synapse pruning, programmed cell death, protein autoprocessing, protein catabolic process, proteolysis, regulation of cell adhesion, regulation of cell fate specification, regulation of development, heterochronic, regulation of locomotion, regulation of protein stability, regulation of synapse organization, regulation of vulval development 8654923 221 1:221 MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVD
PSQ01290 FD00131 Caspase-3 P42574 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 aspartic-type endopeptidase activity, cyclin-dependent protein serine/threonine kinase inhibitor activity, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, death receptor binding, peptidase activity, phospholipase A2 activator activity, protease binding, protein-containing complex binding 277 Apopain, Cysteine protease CPP32, Protein Yama, SREBP cleavage activity 1 CASP3 9606 cytoplasm, cytosol, death-inducing signaling complex, membrane raft, neuronal cell body, nucleoplasm, nucleus anterior neural tube closure, apoptotic DNA fragmentation, apoptotic process, apoptotic signaling pathway, axonal fasciculation, B cell homeostasis, cell fate commitment, cellular response to DNA damage stimulus, cellular response to staurosporine, cytokine-mediated signaling pathway, erythrocyte differentiation, execution phase of apoptosis, extrinsic apoptotic signaling pathway in absence of ligand, glial cell apoptotic process, heart development, hippo signaling, hippocampus development, intrinsic apoptotic signaling pathway in response to osmotic stress, keratinocyte differentiation, learning or memory, leukocyte apoptotic process, luteolysis, negative regulation of activated T cell proliferation, negative regulation of apoptotic process, negative regulation of B cell proliferation, neuron apoptotic process, neuron differentiation, neurotrophin TRK receptor signaling pathway, platelet formation, positive regulation of amyloid-beta formation, positive regulation of apoptotic process, positive regulation of neuron apoptotic process, protein processing, proteolysis, regulation of macroautophagy, regulation of protein stability, response to amino acid, response to antibiotic, response to cobalt ion, response to drug, response to estradiol, response to glucocorticoid, response to glucose, response to hydrogen peroxide, response to hypoxia, response to lipopolysaccharide, response to nicotine, response to tumor necrosis factor, response to UV, response to X-ray, sensory perception of sound, striated muscle cell differentiation, T cell homeostasis, wound healing 7596430 19 10:28 SKSIKNLEPKIIHGSESMD
PSQ01291 FD00390 Astacin-like metalloendopeptidase P42662 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Perdicinae Coturnix Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) 67 aspartic-type peptidase activity, glutamic-type peptidase activity, metalloendopeptidase activity, peptidase activity, zinc ion binding 409 Chorioallantoic membrane-1 , Quail hatching enzyme None 93934 cortical granule, cytoplasm, plasma membrane, transport vesicle cell adhesion, fertilization, negative regulation of binding of sperm to zona pellucida, positive regulation of protein processing, prevention of polyspermy 16003522 67 20:86 FPIQDNYENSTATSESTQVTTEESIYDSPSPTETDSEDDVIFNRILEVNKDSSRYLQEGDIVPRRSR
PSQ01292 FD00397 Platelet basic protein P43030 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 6 chemokine activity, CXCR chemokine receptor binding, growth factor activity 120 C-X-C motif chemokine 7, Small-inducible cytokine B7 PPBP 9823 extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, chemokine-mediated signaling pathway, inflammatory response, neutrophil chemotaxis, positive regulation of cell division 7513641 6 34:39 VPATMG
PSQ01293 FD00049 Thermolysin P43133 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus stearothermophilus (Bacillus stearothermophilus) 204 metal ion binding, metalloendopeptidase activity 551 Neutral protease nprS 1422 extracellular region None 2203733, 3149972 204 32:235 STEHVTWNQQFQTPQFISGDLLKVNGTSPEELVYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTAHVKDGTLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVYVNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKS
PSQ01294 FD00132 Pro-adrenomedullin P43145 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 47, 36 adrenomedullin receptor binding, hormone activity 185 None Adm 10116 cytoplasm, extracellular space adenylate cyclase-activating G protein-coupled receptor signaling pathway, adrenomedullin receptor signaling pathway, aging, amylin receptor signaling pathway, androgen metabolic process, animal organ regeneration, branching involved in labyrinthine layer morphogenesis, calcium ion homeostasis, cAMP-mediated signaling, developmental growth, female pregnancy, G protein-coupled receptor internalization, heart development, hormone secretion, negative regulation of cell population proliferation, negative regulation of vascular permeability, negative regulation of vasoconstriction, neural tube closure, neuron projection regeneration, odontogenesis of dentin-containing tooth, positive regulation of angiogenesis, positive regulation of apoptotic process, positive regulation of cell population proliferation, positive regulation of cytosolic calcium ion concentration, positive regulation of heart rate, positive regulation of vasculogenesis, receptor internalization, regulation of systemic arterial blood pressure, regulation of the force of heart contraction, regulation of urine volume, response to cold, response to glucocorticoid, response to hypoxia, response to insulin, response to lipopolysaccharide, response to organic substance, response to starvation, response to wounding, spongiotrophoblast layer development, vascular associated smooth muscle cell development, vasculogenesis 26479776;26479776 83 45:91, 150:185 ELQASSSYPTGLVDEKTVPTQTLGLQDKQSTSSTPQASTQSTAHIRV, SLPEVLRARTVESSQEQTHSAPASPAHQDISRVSRL
PSQ01295 FD00399 Virulence metalloprotease P43147 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio anguillarum (Listonella anguillarum) 174 metal ion binding, metalloendopeptidase activity 611 Vibriolysin empA 55601 extracellular region pathogenesis 2228244 174 26:199 AKMVQVDDPSLLEQALSMQARSIVPTQNGFQVVKSVTLPNGKVKVRYQQMYHGLPVFNTSVVATQTEKGIGQVYGMLAQQIDSDVVSTSPQVEQKQAVSIALTHYQQQNPSLTSADLVTENERAQLMVRLDENQMAQMVYLVDFFVATNEPARPFFFIDANSGDVLQTWEGLNH
PSQ01296 FD00548 Collagenase ColA P43153 Bacteria Firmicutes Clostridia Clostridiales Clostridiaceae Clostridium Clostridium perfringens (strain 13 47 metalloendopeptidase activity, serine-type endopeptidase activity, zinc ion binding 1104 120 kDa collagenase, Microbial collagenase colA 195102 extracellular region pathogenesis 8282691 47 40:86 ADKKVENSNNGQITREINADQISKTELNNEVATDNNRPLGPSIAPSR
PSQ01297 FD00386 Extracellular small neutral protease P43163 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces sp 53 metalloendopeptidase activity, zinc ion binding 229 Snapalysin snpA 45212 extracellular region None 1569011 53 29:81 TPTAEGAPVVAYDGSPSAGSPADAKAEAAANRAFFEAVLRSVAEKRAANPKST
PSQ01298 FD00049 Bacillolysin P43263 Bacteria Firmicutes Bacilli Bacillales Paenibacillaceae Brevibacillus Brevibacillus brevis (Bacillus brevis) 195 metal ion binding, metalloendopeptidase activity 527 Neutral protease npr 1393 extracellular region None 2127074 195 29:223 KTKIDYHKQWDTPQYIGEVWEPEGAKGDDVVWSYLEKYKDEFRIQGNVEDHFEIVNEARNKETDTKHYRLQEVYNGIPIYGFQQTVHIDADGNVTSFLGQFIPDLDSNKQLKKKPKLNEQKAVKQAIKDVEGEVGEKPDFIQDPEAKLYIYVHEDESYLAYAVELNFLDPEPGRWMYFIDAHSGDVINKYNMLDH
PSQ01299 FD00147 Cysteine proteinase RD21A P43297 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 115, 110 cysteine-type endopeptidase activity, cysteine-type peptidase activity, peptidase activity 462 Protein RESPONSIVE TO DEHYDRATION 21 RD21A 3702 apoplast, cytoplasm, cytoplasmic stress granule, extracellular space, Golgi apparatus, lysosome, nucleus, P-body, plasma membrane, plasmodesma, secretory vesicle, vacuole defense response to fungus, protein ubiquitination, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of stomatal closure 22396764;22396764 225 22:136, 353:462 VDMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSLRYEARVGDE, KNGENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRKNIA
PSQ01300 FD00155 Pro-neuregulin-1 P43322 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 13 chemorepellent activity, ErbB-2 class receptor binding, ErbB-3 class receptor binding, growth factor activity, integrin binding, protein tyrosine kinase activator activity, receptor tyrosine kinase binding, signaling receptor binding, transcription coregulator activity 662 None Nrg1 10116 axolemma, axon, cell body, cytoplasm, dendrite, external side of plasma membrane, extracellular region, extracellular space, GABA-ergic synapse, glutamatergic synapse, integral component of plasma membrane, neuromuscular junction, nucleus, plasma membrane, synapse activation of MAPK activity, activation of protein kinase B activity, activation of transmembrane receptor protein tyrosine kinase activity, animal organ development, axon ensheathment, brain development, cardiac conduction system development, cardiac muscle cell differentiation, cardiac muscle cell myoblast differentiation, cardiac muscle tissue development, cell differentiation, cell migration, cell morphogenesis, chemorepulsion involved in interneuron migration from the subpallium to the cortex, endocardial cell differentiation, ERBB signaling pathway, ERBB3 signaling pathway, glial cell differentiation, glial cell fate commitment, heart development, intracellular signal transduction, locomotory behavior, MAPK cascade, memory, muscle organ development, myelination in peripheral nervous system, negative regulation of corticosterone secretion, negative regulation of neuron migration, negative regulation of protein catabolic process, negative regulation of secretion, negative regulation of transcription, DNA-templated, nervous system development, neurogenesis, neuron fate commitment, neurotransmitter receptor metabolic process, oligodendrocyte differentiation, peripheral nervous system development, positive regulation of axon extension, positive regulation of axon regeneration, positive regulation of calcineurin-NFAT signaling cascade, positive regulation of cardiac muscle cell differentiation, positive regulation of cell population proliferation, positive regulation of dendritic spine development, positive regulation of gene expression, positive regulation of myelination, positive regulation of neuron projection development, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of protein kinase activity, positive regulation of protein kinase B signaling, positive regulation of protein localization to cell surface, positive regulation of protein-containing complex assembly, positive regulation of Ras protein signal transduction, positive regulation of Schwann cell proliferation, positive regulation of striated muscle cell differentiation, positive regulation of transcription by RNA polymerase II, postsynapse to nucleus signaling pathway, regulation of cell differentiation, response to progesterone, startle response, synapse assembly, ventricular trabecula myocardium morphogenesis 1348215 13 1:13 MSERKEGRGKGKG
Total Pages 43
Go to Lab Web Page