Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01001 FND00036 Excelsatoxin A P0DQP3 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Urticaceae Dendrocnide Dendrocnide excelsa (Giant stinging tree) (Urera excelsa) 17 None 73 None None 647263 None None 32938666 17 21:37 DESSEDIDNIVIKTPLD
PSQ01002 FND00036 Moroidotoxin A P0DQP4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Urticaceae Dendrocnide Dendrocnide moroides (Gympie stinging tree) (Laportea moroides) 17 None 80 None None 1842752 None None 32938666 17 28:44 DESSEDIDNIVIKTPLD
PSQ01003 FND00111 U-myrmicitoxin(01)-Tb3a P0DSI4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmicinae Tetramorium Tetramorium bicarinatum (Tramp ant) 14 toxin activity 60 None None 219812 extracellular region None 30214940 14 27:40 KAGADADADAHADA
PSQ01004 FD00026 U-myrmicitoxin(01)-Tb4a P0DSI5 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmicinae Tetramorium Tetramorium bicarinatum (Tramp ant) 12 toxin activity 60 None None 219812 extracellular region None 30214940 12 27:38 DAMADADADAAI
PSQ01005 FND00289 U-myrmicitoxin(01)-Tb5a P0DSI6 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmicinae Tetramorium Tetramorium bicarinatum (Tramp ant) 12 toxin activity 60 None None 219812 extracellular region None 30214940 12 27:38 DAWADANADADV
PSQ01006 FD00026 U-myrmeciitoxin(01)-Mg1a P0DSJ4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 26 toxin activity 86 None None 36170 extracellular region, membrane, other organism cell membrane cytolysis, defense response to bacterium 30214940 26 27:52 KALADPESDAVGFADAFGDADAEATG
PSQ01007 FND00130 U-myrmeciitoxin(01)-Mg2a P0DSJ5 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 24 None 84 None None 36170 extracellular region None 30214940 24 24:47 ESVATAISDSEAEPLAESFAEPLA
PSQ01008 FD00026 U-myrmeciitoxin(01)-Mg5a P0DSJ8 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 17 None 60 None None 36170 extracellular region None 30214940 17 22:38 SNVEAKASADPEPDAVG
PSQ01009 FD00026 U-myrmeciitoxin(01)-Mg5b P0DSJ9 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 17 None 60 None None 36170 extracellular region None 30214940 17 22:38 SNVEAKASADPEPDAVG
PSQ01010 FND00340 M-poneratoxin-Dq3a P0DSK0 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Ponerinae Ponerini Dinoponera Dinoponera quadriceps (South American ant) 20 None 66 Dinoponeratoxin , Peptide sDq-2561 , U-poneritoxin(01)-Dq6a None 609295 extracellular region defense response to other organism 24498135 20 24:43 EAEAEAEADADADAKAEAEA
PSQ01011 FND00149 U-myrmeciitoxin(01)-Mg6a P0DSK1 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 13 toxin activity 46 None None 36170 extracellular region None 30214940 13 21:33 VIPIANADAEADT
PSQ01012 FND00138 M-poneratoxin-Dq4e P0DSK2 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Ponerinae Ponerini Dinoponera Dinoponera quadriceps (South American ant) 14 None 69 Peptide sDq-3348 , U-poneritoxin(01)-Dq7a , contig 9 None 609295 extracellular region None 24498135 14 26:39 AALADADADAEAIA
PSQ01013 FD00026 U-myrmeciitoxin(01)-Mg7a P0DSK3 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 51 None 135 None None 36170 extracellular region None 30214940 51 22:72 PNMEVKALAGPEADAIGFADAFGEADAFGEADAFGEADAFGEADAFGEADA
PSQ01014 FD00026 U-myrmeciitoxin(01)-Mg7c P0DSK4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 33 None 100 None None 36170 extracellular region None 30214940 33 18:50 IVYSPHMEVKALADAEPDAIGFADAFGEADAEP
PSQ01015 FND00035 U-myrmeciitoxin(01)-Mg8a P0DSK5 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 24 None 120 None None 36170 extracellular region None 30214940 24 21:44 TPSTNAKALAESNALAVAVSEAEP
PSQ01016 FND00035 U-myrmeciitoxin(01)-Mg8b P0DSK6 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 24 None 118 None None 36170 extracellular region None 30214940 24 21:44 TPSTNAKALAESNALAVADPEAEP
PSQ01017 FD00047 U-myrmeciitoxin(01)-Mg9a P0DSK7 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 27 None 79 None None 36170 extracellular region None 30214940 27 22:48 PNVEAKALANPESDAIGFADAVGEADP
PSQ01018 FD00088 U-myrmeciitoxin(02)-Mg1a P0DSL4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia gulosa (Red bulldog ant) 13 toxin activity 80 None None 36170 extracellular region None 30214940 13 18:30 LLISVISIKECTA
PSQ01019 FND00001 Temporin-ALh P0DTU1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Amolops Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis) 24 None 64 None None 318551 extracellular region defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 19843479 24 23:46 EQERNAEEERRDEPDERNAEVEKR
PSQ01020 FD00506 Pumilarin P0DTW2 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus safensis 38 None 108 Circular bacteriocin , Enterocin AS-48-like , Head-to-tail cyclized peptide None 561879 extracellular region cytolysis, defense response to bacterium 29177092 38 1:38 MTETKNEIKLHVLFGALAVGFLMLALFSFSLQMLPVAD
PSQ01021 FD00019 U1-theraphotoxin-Tal1a P0DUC0 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Brachypelma Tliltocatl albopilosus (Curlyhair tarantula) (Brachypelma albopilosum) 35 sodium channel inhibitor activity, toxin activity 99 Brachyin None 351119 extracellular region None 25329070 35 23:57 DEDSAETSLLRKLKEAEASLFGQHLEESQHSREKR
PSQ01022 FND00205 Antimicrobial peptide AmAMP1 P0DUG2 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Scleractinia Astrocoeniina Acroporidae Acropora Acropora millepora (Staghorn coral) (Heteropora millepora) 48 None 120 None None 45264 None None 32937163 48 26:73 ASIVKDVDEDETLENEDGEAMENSWPWHGVEDTSDYSDLSDLANSEKR
PSQ01023 FD00171 Pteroicidin-alpha P0DUJ5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Perciformes Scorpaenoidei Scorpaenidae Pteroinae Pterois Pterois volitans (Red lionfish) (Gasterosteus volitans) 23 None 66 Piscidin-like peptide None 185886 None None 29108968 23 44:66 GKNRDMAEQQELERAFDRERAFA
PSQ01024 FD00012 Caricain P10056 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Caricaceae Carica Carica papaya (Papaya) 116 cysteine-type peptidase activity 348 Papaya peptidase A, Papaya proteinase III, Papaya proteinase omega None 3649 None None 3063283 116 17:132 LFVHMSVSFGDFSIVGYSQDDLTSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDEEFINEDTVN
PSQ01025 FD00593 Lysosomal alpha-glucosidase P10253 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 42 alpha-1,4-glucosidase activity, carbohydrate binding, hydrolase activity, hydrolyzing O-glycosyl compounds, maltose alpha-glucosidase activity 959 Acid maltase, Aglucosidase alfa GAA 9606 azurophil granule membrane, extracellular exosome, ficolin-1-rich granule membrane, intracellular membrane-bounded organelle, lysosomal lumen, lysosomal membrane, lysosome, membrane, plasma membrane, tertiary granule membrane cardiac muscle contraction, diaphragm contraction, glucose metabolic process, glycogen catabolic process, heart morphogenesis, locomotory behavior, lysosome organization, maltose metabolic process, muscle cell cellular homeostasis, neuromuscular process controlling balance, neuromuscular process controlling posture, neutrophil degranulation, regulation of the force of heart contraction, sucrose metabolic process, tissue development, vacuolar sequestering 3049072 42 28:69 GHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQ
PSQ01026 FD00477 Lipase 2 P10335 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus 258 metal ion binding, triglyceride lipase activity 690 Glycerol ester hydrolase 2 lip2 1280 extracellular region lipid catabolic process 1548232 258 38:295 SEKTSTNAAAQKETLNQPGEQGNAITSHQMQSGKQLDDMHKENGKSGTVTEGKDTLQSSKHQSTQNSKTIRTQNDNQVKQDSERQGSKQSHQNNATNNTERQNDQVQNTHHAERNGSQSTTSQSNDVDKSQPSIPAQKVIPNHDKAAPTSTTPPSNDKTAPKSTKAQDATTDKHPNQQDTHQPAHQIIDAKQDDTVRQSEQKPQVGDLSKHIDGQNSPEKPTDKNTDNKQLIKDALQAPKTRSTTNAAADAKKVRPLK
PSQ01027 FD00338 Killer toxin HM-1 P10410 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Phaffomycetaceae Cyberlindnera Cyberlindnera mrakii (Yeast) (Williopsis mrakii) 18 toxin activity 125 None HMK 1004253 extracellular region cell death, pathogenesis 3943610 18 20:37 LPSEILSTGYERSALEKR
PSQ01028 FD00092 Interleukin-1 beta P10749 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 117 cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding 269 None Il1b 10090 autophagosome, cytosol, extracellular region, extracellular space, lysosome, secretory granule, vesicle activation of MAPK activity, astrocyte activation, cellular response to drug, cellular response to lipopolysaccharide, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, leukocyte migration, lipopolysaccharide-mediated signaling pathway, MAPK cascade, memory, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of branching morphogenesis of a nerve, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of gene expression, negative regulation of glucose transmembrane transport, negative regulation of glutamate secretion, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neural precursor cell proliferation, negative regulation of neurogenesis, negative regulation of neuron differentiation, negative regulation of synaptic transmission, negative regulation of transcription by RNA polymerase II, neutrophil chemotaxis, positive regulation of angiogenesis, positive regulation of apoptotic process, positive regulation of astrocyte differentiation, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell death, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of chemokine production, positive regulation of complement activation, positive regulation of cytosolic calcium ion concentration, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of ERK1 and ERK2 cascade, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell differentiation, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of JUN kinase activity, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuron apoptotic process, positive regulation of neutrophil chemotaxis, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of stress-activated MAPK cascade, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, protein kinase B signaling, regulation of defense response to virus by host, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to ATP, response to carbohydrate, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, social behavior, vascular endothelial growth factor production 2967326 117 1:117 MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCD
PSQ01029 FD00075 Zona pellucida sperm-binding protein 3 P10761 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 73 acrosin binding, carbohydrate binding, identical protein binding, receptor ligand activity, structural constituent of egg coat 424 Sperm receptor, Zona pellucida glycoprotein 3, Zona pellucida protein C Zp3 10090 collagen-containing extracellular matrix, egg coat, extracellular matrix, extracellular space, integral component of membrane, plasma membrane binding of sperm to zona pellucida, blastocyst formation, egg coat formation, humoral immune response mediated by circulating immunoglobulin, negative regulation of binding of sperm to zona pellucida, negative regulation of transcription, DNA-templated, oocyte development, phosphatidylinositol-mediated signaling, positive regulation of acrosomal vesicle exocytosis, positive regulation of acrosome reaction, positive regulation of antral ovarian follicle growth, positive regulation of humoral immune response, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-4 production, positive regulation of leukocyte migration, positive regulation of ovarian follicle development, positive regulation of T cell proliferation, positive regulation of transcription, DNA-templated, positive regulation of type IV hypersensitivity, regulation of signaling receptor activity 12799386 73 352:424 RRHVTDEADVTVGPLIFLGKANDQTVEGWTASAQTSVALGLGLATVAFLTLAAIVLAVTRKCHSSSYLVSLPQ
PSQ01030 FD00173 Mating pheromone Er-1 P10774 Eukaryota Sar Alveolata Ciliophora Intramacronucleata Spirotrichea Hypotrichia Euplotida Euplotidae Euplotes Euplotes raikovi 16 pheromone activity 75 Euplomone R1 MAT1, MAT3 5938 extracellular region, plasma membrane None 1549567, 3142868 16 20:35 FRFQSRLRSNVEAKTG
PSQ01031 FD00031 Phormicin P10891 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Oestroidea Calliphoridae Chrysomyinae Protophormia Protophormia terraenovae (Northern blowfly) (Lucilia terraenovae) 31 None 94 Insect defensin A None 34676 extracellular region defense response to bacterium, innate immune response 2911573 31 24:54 IPADAANDAHFVDGVQALKEIEPELHGRYKR
PSQ01032 FD00062 Lantibiotic subtilin P10946 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis 24 signaling receptor binding 60 None spaS 1423 extracellular region cytolysis, defense response to bacterium 4154277 24 1:24 MSKFDDFDLDVVKVSKQDSKITPQ
PSQ01033 FD00135 Secretin P11384 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 10, 72 digestive hormone activity, G protein-coupled receptor binding, hormone activity, protein N-terminus binding, signaling receptor binding 134 None Sct 10116 extracellular space brain development, cellular water homeostasis, dentate gyrus development, diet induced thermogenesis, embryonic digestive tract development, hippocampus development, negative regulation of gastrin-induced gastric acid secretion, negative regulation of neuron apoptotic process, neuronal stem cell population maintenance, positive regulation of cAMP-mediated signaling, positive regulation of lipid catabolic process, positive regulation of pancreatic juice secretion, positive regulation of somatostatin secretion, regulation of appetite, regulation of synaptic plasticity, response to nutrient levels, visual learning 2719704;2719704 82 22:31, 63:134 FVLPAPPRTP, SEEDTENIPENSVARPKPLEDQLCLLWSNTQALQDWLLPRLSLDGSLSLWLPPGPRPAVDHSEWTETTRQPR
PSQ01034 FD00016 Neutrophil cationic peptide 1 type A P11478 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Hystricomorpha Caviidae Cavia Cavia porcellus (Guinea pig) 43 None 93 GNCP-1A None 10141 extracellular space defense response to bacterium, defense response to fungus, defense response to virus, killing of cells of other organism 1659400, 2473036, 3623703 43 20:62 EPLPRAADHSDTKMKGDREDHVAVISFWEEESTSLEDAGAGAG
PSQ01035 FD00027 Ligninase H2 P11542 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Polyporales Phanerochaetaceae Phanerochaete Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) 7 diarylpropane peroxidase activity, heme binding, metal ion binding 372 Diarylpropane peroxidase, LG4, Lignin peroxidase GLG4 5306 None hydrogen peroxide catabolic process, lignin catabolic process, response to oxidative stress 2303054, 3240864 7 22:28 APNLDKR
PSQ01036 FD00069 Eosinophil peroxidase P11678 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 122 heme binding, metal ion binding, peroxidase activity 720 None EPX 9606 extracellular exosome, extracellular region, extracellular space, secretory granule lumen defense response to bacterium, defense response to nematode, eosinophil migration, hydrogen peroxide catabolic process, negative regulation of interleukin-10 production, negative regulation of interleukin-5 production, neutrophil degranulation, positive regulation of interleukin-4 production, response to oxidative stress 2541222 122 18:139 QPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAE
PSQ01037 FD00161 Pulmonary surfactant-associated protein C P11686 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 23 identical protein binding 197 Pulmonary surfactant-associated proteolipid SPL(Val), SP5 SFTPC 9606 alveolar lamellar body, clathrin-coated endocytic vesicle, endoplasmic reticulum membrane, extracellular region, extracellular space, lamellar body, multivesicular body lumen cellular protein metabolic process, respiratory gaseous exchange by respiratory system 3366248 23 1:23 MDVGSKEVLMESPPDYSAAPRGR
PSQ01038 FD00030 Endothiapepsin P11838 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Diaporthales Cryphonectriaceae Cryphonectria-Endothia species complex Cryphonectria Cryphonectria parasitica (Chestnut blight fungus) (Endothia parasitica) 69 aspartic-type endopeptidase activity 420 Aspartate protease EAPA 5116 None None 3305016 69 21:89 SPTKQHVGIPVNASPEVGPGKYSFKQVRNPNYKFNGPLSVKKTYLKYGVPIPAWLEDAVQNSTSGLAER
PSQ01039 FND00118 Spore coat protein T P11863 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 19 None 82 None cotT 224308 spore wall sporulation resulting in formation of a cellular spore 2546006 19 1:19 MDYPLNEQSFEQITPYDER
PSQ01040 FD00275 Pilin P12060 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Salmonella Salmonella typhi 55 None 120 None traA 90370 extracellular region, integral component of membrane, plasma membrane conjugation 6130062 55 1:55 MNLSFAKGGLPAPVKNRAWQYCQMAWRGVTSKKALSRLAALSPLLLLGVGQMASA
PSQ01041 FD00072 Photosystem II reaction center protein K P12163 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Chenopodiaceae Chenopodioideae Anserineae Spinacia Spinacia oleracea (Spinach) 22 None 60 None psbK 3562 chloroplast thylakoid membrane, integral component of membrane, photosystem II reaction center photosynthesis 2644131, 9632665 22 1:22 MLNIFSLICLNSALYSSSFFFG
PSQ01042 FD00173 Mating pheromone Er-10 P12350 Eukaryota Sar Alveolata Ciliophora Intramacronucleata Spirotrichea Hypotrichia Euplotida Euplotidae Euplotes Euplotes raikovi 18 pheromone activity 75 Euplomone R10 MAT10 5938 extracellular region None 2504286 18 20:37 FRFQSRIRSNVEAKTETR
PSQ01043 FD00083 Vignain P12412 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Vigna Vigna mungo (Black gram) (Phaseolus mungo) 106 cysteine-type peptidase activity 362 Bean endopeptidase, Cysteine proteinase, Sulfhydryl-endopeptidase None 3915 aleurone grain, endoplasmic reticulum lumen, vacuole None 8076688 106 21:126 NSFDFHEKDLESEESLWDLYERWRSHHTVSRSLGEKHKRFNVFKANVMHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHKMFRGSQHGSGTFMYEKVG
PSQ01044 FD00493 NAD(+)--arginine ADP-ribosyltransferase P12726 Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) 6 NAD(P)+-protein-arginine ADP-ribosyltransferase activity, NAD+-protein-arginine ADP-ribosyltransferase activity, NADP+-protein-arginine ADP-ribosyltransferase activity 682 Alt protein alt 10665 extracellular region, virion pathogenesis, peptidyl-arginine ADP-ribosylation, protein ADP-ribosylation, regulation of viral transcription 8053153 6 1:6 MELITE
PSQ01045 FND00348 Neuromedin-U P12760 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 68 neuromedin U receptor binding, type 1 neuromedin U receptor binding, type 2 neuromedin U receptor binding 180 None Nmu 10116 extracellular region, terminal bouton eating behavior, energy homeostasis, gastric acid secretion, negative regulation of eating behavior, negative regulation of feeding behavior, negative regulation of gastric acid secretion, negative regulation of gastric emptying, neuropeptide signaling pathway, photoperiodism, positive regulation of cytosolic calcium ion concentration, positive regulation of heart rate, positive regulation of heat generation, positive regulation of hormone secretion, positive regulation of prolactin secretion, positive regulation of sensory perception of pain, positive regulation of smooth muscle contraction, positive regulation of stomach fundus smooth muscle contraction, positive regulation of synaptic transmission, positive regulation of systemic arterial blood pressure, regulation of circadian sleep/wake cycle, sleep, regulation of feeding behavior, regulation of grooming behavior, sensory perception of pain, temperature homeostasis 28874765 68 38:105 CRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKR
PSQ01046 FD00062 Lantibiotic nisin-A P13068 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 23 signaling receptor binding 60 None spaN 1360 extracellular region cytolysis, defense response to bacterium 5131162 23 1:23 MSTKDFNLDLVSVSKKDSGASPR
PSQ01047 FD00012 Digestive cysteine proteinase 1 P13277 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea Nephropoidea Nephropidae Homarus Homarus americanus (American lobster) 89 cysteine-type peptidase activity 322 None LCP1 6706 None None 2597115 89 17:105 NPSWEEFKGKFGRKYVDLEEERYRLNVFLDNLQYIEEFNKKYERGEVTYNLAINQFSDMTNEKFNAVMKGYKKGPRPAAVFTSTDAAPE
PSQ01048 FD00437 Gamma-interferon-inducible lysosomal thiol reductase P13284 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 31, 18 oxidoreductase activity, oxidoreductase activity, acting on a sulfur group of donors 250 Gamma-interferon-inducible protein IP-30, Legumaturain IFI30 9606 cell junction, cytosol, extracellular region, intracellular membrane-bounded organelle, lysosomal lumen, lysosome antigen processing and presentation of exogenous peptide antigen via MHC class I, antigen processing and presentation of exogenous peptide antigen via MHC class II, interferon-gamma-mediated signaling pathway, negative regulation of fibroblast proliferation, protein stabilization 10639150;10639150 49 27:57, 233:250 SPLQALDFFGNGPPVNYKTGNLYLRGPLKKS, KPDVCPSSTSSLRSVCFK
PSQ01049 FD00402 L-shaped tail fiber protein pb1 P13390 Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Demerecviridae Markadamsvirinae Tequintavirus Escherichia phage T5 (Enterobacteria phage T5) 133 serine-type peptidase activity 1396 Tail protein pb1 ltf 10726 virus tail, fiber adhesion receptor-mediated virion attachment to host cell, lipopolysaccharide-mediated virion attachment to host cell, viral entry into host cell 24316831 133 1264:1396 SDARLKNDVRAMSDPETEAAKAIAKEIGFWTWKEQADMNDIREHCGLTVQRAIEIMESFGLDPFKYGFICYDKWDEHTVVSEYGPANEDGTENPIYKTIPAGDHYSFRLEELNLFIAKGFEARLSAIEDKLGM
PSQ01050 FD00185 Bone morphogenetic protein 1 P13497 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 98 calcium ion binding, cytokine activity, growth factor activity, identical protein binding, metalloendopeptidase activity, metallopeptidase activity, peptidase activity, zinc ion binding 986 Mammalian tolloid protein, Procollagen C-proteinase BMP1 9606 extracellular region, extracellular space, Golgi apparatus, vesicle cartilage condensation, cell differentiation, collagen fibril organization, extracellular matrix disassembly, high-density lipoprotein particle assembly, multicellular organism development, ossification, positive regulation of cartilage development, proteolysis, skeletal system development 12637569 98 23:120 LDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
Total Pages 43
Go to Lab Web Page