Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ02101 | FD00011 | Subtilisin-like serine protease Pen c 1 | Q9Y749 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium | Penicillium citrinum | 96 | serine-type endopeptidase activity | 397 | Alkaline serine protease | None | 5077 | extracellular space | proteolysis | 10103041, 10377244, 7763554, 9117886 | 96 | 20:115 | GTLLTASNTDAVIPSSYIVVMNDDVSTAEFNTHREWATNVHARLSRRKNGETGPGKHFEINGLKGYTASFDESTAKDIANDPAVKYIEPDMIVNAT | |
PSQ02102 | FD00011 | Subtilisin-like serine protease Pen c 2 | Q9Y755 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium | Penicillium citrinum | 120 | serine-type endopeptidase activity | 457 | Vacuolar serine protease Pen c 2 | None | 5077 | None | proteolysis | 10377244 | 120 | 17:136 | SPVSVESIHNGAAPIISSMNSQEIPDSYIVVFKKHVDTSAAAAHHSWVQDIHSAVNGRMELKKRGLFGFDTDAFLGVKHSFHVAGSLMGYAGHFHEDVIEQVRRHPDVDYIEKDSEVHHF | |
PSQ02103 | FD00011 | Subtilisin-like proteinase Mp1 | Q9Y778 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Magnaporthales Magnaporthaceae Magnaporthiopsis | Magnaporthiopsis poae (Kentucky bluegrass fungus) (Magnaporthe poae) | 93 | serine-type endopeptidase activity | 404 | None | None | 148304 | extracellular region | None | 10415340 | 93 | 20:112 | APVDKQATQVVPNSYIITLKQGASAASFHNHLSWVGDVHRRSVSKRDTTGVDKVFDLDGFTAYSGSFDAATLQEIKKSDEVAFVEPDQVWDLY | |
PSQ02104 | FD00452 | 1,3-beta-glucanosyltransferase gas4 | Q9Y7Y7 | Eukaryota Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces | Schizosaccharomyces pombe (strain 972 | 24 | 1,3-beta-glucanosyltransferase activity | 456 | None | gas4 | 284812 | anchored component of membrane, cell wall, endoplasmic reticulum, fungal-type cell wall, plasma membrane, prospore membrane | ascospore wall beta-glucan biosynthetic process, ascospore-type prospore assembly, cell wall (1-, fungal-type cell wall (1-, fungal-type cell wall organization | 12845604 | 24 | 433:456 | GSSKIGVAFCQALFITVLIATLSF | |
PSQ02105 | FD00015 | Zinc metalloproteinase | Q9YI19 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Gloydius | Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys, brevicaudus) | 164 | metal ion binding, metalloendopeptidase activity, toxin activity | 480 | None | None | 259325 | extracellular region | None | 9880798 | 164 | 21:184 | IILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYEFKVNGEPVVLHLEKNKGLFSKGYSETHYSPDGRKITTNPPVEDHCYYHGRIQNDADSTASISACNGLKGHFKHQGEMYLIEPLKLSDSEAHAVYKYENVEKEDEAPKMCGVTQTNWKSDEPIKASQ | |
PSQ02106 | FD00088 | Proepiregulin | Q9Z0L5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 33 | epidermal growth factor receptor binding, growth factor activity | 162 | None | Ereg | 10116 | extracellular space, integral component of membrane, plasma membrane | angiogenesis, cell population proliferation, cell-cell signaling, cytokine-mediated signaling pathway, epidermal growth factor receptor signaling pathway, female meiotic nuclear division, keratinocyte proliferation, luteinizing hormone signaling pathway, mRNA transcription, negative regulation of cell population proliferation, negative regulation of smooth muscle cell differentiation, negative regulation of transcription, DNA-templated, oocyte maturation, ovarian cumulus expansion, ovulation, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of cytokine production, positive regulation of DNA replication, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of fibroblast proliferation, positive regulation of innate immune response, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of phosphorylation, positive regulation of protein kinase activity, positive regulation of smooth muscle cell proliferation, primary follicle stage, response to peptide hormone | 9990076 | 33 | 23:55 | VISTTVIPSCIPEESEDNCTALVQMEDDPRVAQ | |
PSQ02107 | FD00415 | Apoptosis-inducing factor 1 | Q9Z0X1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 47 | DNA binding, electron-transferring-flavoprotein dehydrogenase activity, FAD binding, NAD(P)H oxidase H2O2-forming activity, NADH dehydrogenase activity, oxidoreductase activity, acting on NAD(P)H, protein dimerization activity | 612 | Programmed cell death protein 8 | Aifm1 | 10090 | cytoplasm, cytosol, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial outer membrane, mitochondrion, nucleus, perinuclear region of cytoplasm | activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic mitochondrial changes, apoptotic process, cellular response to aldosterone, cellular response to estradiol stimulus, cellular response to hydrogen peroxide, cellular response to nitric oxide, cellular response to oxygen-glucose deprivation, intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress, mitochondrial respiratory chain complex assembly, mitochondrial respiratory chain complex I assembly, neuron apoptotic process, neuron differentiation, positive regulation of apoptotic process, positive regulation of cell death, positive regulation of neuron apoptotic process, protein import into mitochondrial intermembrane space, regulation of apoptotic DNA fragmentation, response to ischemia, response to L-glutamate, response to oxidative stress, response to toxic substance | 9989411 | 47 | 55:101 | SSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGL | |
PSQ02108 | FD00115 | Neutrophil antibiotic peptide NP-3B | Q9Z1F1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 39 | None | 87 | Neutrophil defensin 3 | None | 10116 | extracellular space | antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism | 2543629 | 39 | 20:58 | ESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVT | |
PSQ02109 | FD00011 | Subtilisin-like serine protease AsES | R4IR27 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Sarocladiaceae Sarocladium | Sarocladium strictum (Black bundle disease fungus) (Acremonium strictum) | 90 | serine-type endopeptidase activity | 388 | Alkaline serine protease AsES , Extra-cellular elicitor protein AsES | AsES | 5046 | extracellular region | None | 23530047 | 90 | 16:105 | APTRRDEPAPLHVPRDVDSLIKDTYIVKYKDITAFSAVDEGLKLLSGKPKHIYKGAFKGFSGKIDAKTLELLRDDPSVDFIEQDAIVTLA | |
PSQ02110 | FD00373 | Endo-acting ulvan lyase | T2KNC2 | Bacteria Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae Formosa | Formosa agariphila (strain DSM 15362 | 87 | lyase activity, metal ion binding | 516 | Endolytic ulvan lyase , Polysaccharide lyase 28 family protein P30 , Polysaccharide utilization locus H protein P30 | None | 1347342 | extracellular region | None | 29948117 | 87 | 430:516 | SVDENAILASDVRVFPNPASDSFTISLKTINHVTVNIYDVLGNTIFKSEFNGDTIQIRNKGQFKAGVYLIQLTDKNNNKYHKKLIVK | |
PSQ02111 | FD00020 | Batroxicidin | U5KJC9 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops atrox (Barba amarilla) (Fer-de-lance) | 133 | None | 189 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 8725 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 25100358 | 133 | 23:155 | HRPLSYGEALELALSIYNSKAGEESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETVCQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGGVEEEEEDEEEQKAEVEKDEEKEDEEKDRPKRV | |
PSQ02112 | FD00020 | Cathelicidin-related peptide isoform 3 | U5KJJ0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus | Crotalus durissus cascavella (Northeastern Brazilian rattlesnake) | 142 | None | 194 | Cathelicidin-related antimicrobial peptide, Vipericidin | None | 184540 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 25100358 | 142 | 23:164 | HRPLSYGEALELAVSVYNGKAGEASLYRLLEAVPQPEWDPSSEGSQQLNFTLKETACQVEEERSLEECGFQEDGVVLECTGYYFFGETPPVVVLSCVPVGGVEEEEEEEEEEQKAEAENDEEVEKEKGDEEKDQPKRVKRFK | |
PSQ02113 | FD00020 | Cathelicidin-related peptide Pt_CRAMP1 | U5KJJ1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja | Pseudonaja textilis (Eastern brown snake) | 128 | None | 184 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 8673 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, hemolysis in other organism | 25100358 | 128 | 23:150 | LPHKPLTYEEAVDLAVSTYNGKSGEESLYRLLEAVPPPKWDPLSESNQELNLTIKETVCLVAEERSLEECDFQDDGAVMGCTGYFFFGESPPVLVLTCEPLGEDEEQNQEEEEEEEKEEDEKDQPRRV | |
PSQ02114 | FD00020 | Crotalicidin | U5KJM4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus | Crotalus durissus terrificus (South American rattlesnake) | 142 | None | 194 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 8732 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, killing of cells of other organism | 25100358 | 142 | 23:164 | HRPLSYGEALELAVSVYNGKAGEASLYRLLEAVPQPEWDPSSEGSQQLNFTLKETACQVEEERSLEECGFQEDGVVLECTGYYFFGETPPVVVLSCVPVGGVEEEEEEEEEEQKAEAENDEEVEKEKGDEEKDQPKRVKRFK | |
PSQ02115 | FD00020 | Cathelicidin-related peptide Pt_CRAMP2 | U5KJM6 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja | Pseudonaja textilis (Eastern brown snake) | 128 | None | 184 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 8673 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 25100358 | 128 | 23:150 | LPHKPLTYEEAVDLAVSTYNGKSGEESLYRLLEAVPPPKWDPLSESNQELNLTIKETVCLVAEERSLEECDFQDDGAVMGCTGYFFFGESPPVLVLTCEPLGEDEEQNQEEEEEEEKEEDEKDQPRRV | |
PSQ02116 | FD00020 | Lutzicidin | U5KJT7 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops lutzi (Sertao lancehead) (Bothrops iglesiasi) | 133 | None | 189 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 1368281 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 25100358 | 133 | 23:155 | HRPLSYGEALELALSVYNSKAGEESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETVCQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGGVEEEEEDEEEQKAEVEKDEEKEDEEKDRPKRV | |
PSQ02117 | FD00020 | Lachesicidin | U5KJZ2 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Lachesis | Lachesis muta rhombeata (Bushmaster) | 138 | None | 194 | Cathelicidin-related antimicrobial peptide , Vipericidin | None | 60219 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 25100358 | 138 | 23:160 | HRPLSYGEALELAVSVYNGKAGEASLYRLLEAVPQPEWDPSSEGSQQLNFTLKETACQVEEERSLEECGFQEDGVVLECTGYYFFGETPPVVVLSCVPVGGVEEEEEEEEEEQKAEAENDEEVEKEKEDEEKDQPKRV | |
PSQ02118 | FD00009 | MSDIN-like toxin proprotein 6 | U5L396 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 35 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 19:35 | MSDINTTRLP, CVGDDIAMVLTRGENLC | |
PSQ02119 | FD00008 | Phallacidin proprotein 2 | U5L397 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 34 | None | PHA | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 18:34 | MSDINATRLP, CVGDDVNRLLTRGESLC | |
PSQ02120 | FD00008 | Amanexitide proprotein 1 | U5L3J5 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 36 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 20:36 | MSDINTARLP, FVSDDIQAVLTRGESLC | |
PSQ02121 | FD00008 | MSDIN-like toxin proprotein 7 | U5L3J7 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 34 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 18:34 | MSDINATRLP, CVGDDVNRLLTRGESLC | |
PSQ02122 | FD00008 | MSDIN-like toxin proprotein 8 | U5L3J9 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 35 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 19:35 | MSDINATRLP, CVGDDIAMVLTRGENLC | |
PSQ02123 | FD00008 | Amanexitide proprotein 2 | U5L3K1 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 36 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 20:36 | MSDINATRLP, FVSDDIQAVLTRGESLC | |
PSQ02124 | FD00008 | MSDIN-like toxin proprotein 5 | U5L3M6 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 37 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 21:37 | MSDINATRLP, CVGDADNFTLTRGENLC | |
PSQ02125 | FD00009 | MSDIN-like toxin proprotein 3 | U5L3M8 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 16 | toxin activity | 34 | None | None | 262245 | None | None | 24050899;24050899 | 26 | 1:10, 19:34 | MSDINVIRAP, CVGDDIEVLRRGEGLS | |
PSQ02126 | FD00009 | MSDIN-like toxin proprotein 1 | U5L3X0 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 14 | toxin activity | 32 | None | None | 262245 | None | None | 24050899;24050899 | 24 | 1:10, 19:32 | MSDINATRLP, CVSDVDSTLTRGER | |
PSQ02127 | FD00008 | Alpha-amanitin proprotein 2 | U5L3X2 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 15 | toxin activity | 33 | None | AMA | 262245 | None | None | 24050899;24050899 | 25 | 1:10, 19:33 | MSDINATRLP, CVGDDVTSVLTRGEA | |
PSQ02128 | FD00008 | Alpha-amanitin proprotein 1 | U5L406 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 35 | None | AMA | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 19:35 | MSDINATRLP, CVGDDVTSVLTRGEALC | |
PSQ02129 | FD00008 | Alpha-amanitin proprotein 5 | U5L408 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 17 | toxin activity | 35 | None | None | 262245 | None | None | 24050899;24050899 | 27 | 1:10, 19:35 | MSDINATRLP, CVGDEVAALLTRGEALC | |
PSQ02130 | FD00009 | MSDIN-like toxin proprotein 2 | U5L409 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Amanitaceae Amanita | Amanita exitialis (Guangzhou destroying angel) | 10, 15 | toxin activity | 33 | None | None | 262245 | None | None | 24050899;24050899 | 25 | 1:10, 19:33 | MSDINATRLP, CISDDNDSTLTRGQR | |
PSQ02131 | FD00083 | Cysteine protease Amb a 11 | V5LU01 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Asterales Asteraceae Asteroideae Heliantheae alliance Heliantheae Ambrosia | Ambrosia artemisiifolia (Short ragweed) | 86, 16 | cysteine-type endopeptidase activity, protein homodimerization activity | 386 | Amino acid thiol protease , Pollen allergen Amb a 11 | None | 4212 | None | None | 25865353;25865353 | 102 | 23:108, 371:386 | FHYHERELESEEGFMGMYDRWREQHNIEMRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANSKISHFQALR, KTTQRLQGIRTKLLEL | |
PSQ02132 | FND00327 | Conotoxin Fla16d | V5V893 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Virgiconus | Conus flavidus (Yellow Pacific cone) | 29 | toxin activity | 76 | Conotoxin Fla16 | None | 101302 | extracellular region | None | 24126141 | 29 | 20:48 | EGDGQAVAGDRNPSEARSTHEHFLQRLIR | |
PSQ02133 | FND00317 | Major capsid protein | V5XVW4 | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Herelleviridae Twortvirinae Kayvirus | Staphylococcus phage S25-3 | 24 | None | 463 | Major head protein | None | 1041526 | viral capsid | None | 23869440 | 24 | 1:24 | MTIEKNLSDVQQKYADQFQEDVVK | |
PSQ02134 | FND00248 | Conotoxin Vc7 | W4VS16 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder | Conus victoriae (Queen Victoria cone) | 27 | toxin activity | 74 | H-Vc7 | None | 319920 | extracellular region | None | 30975904 | 27 | 23:49 | IPVADDLEADRDTDPDEKDPSVHNYWR | |
PSQ02135 | FD00003 | O2 contryphan Vc1 | W4VSF6 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder | Conus victoriae (Queen Victoria cone) | 44 | None | 103 | Contryphan Vc1 | None | 319920 | None | None | 26774129 | 44 | 24:67 | DGAHERTEAEEPQHHGAKRQDGTGGYPVDDVDMMQRIFRTPLKR | |
PSQ02136 | FND00189 | Conotoxin Vc1 | W4VSG7 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder | Conus victoriae (Queen Victoria cone) | 36 | None | 77 | H_Vc1 | None | 319920 | extracellular region | None | 25464369 | 36 | 23:58 | HPNADAGDATRDVGSDRTSVELSKMLKGWQAEKGQR | |
PSQ02137 | FND00183 | DELTA-miturgitoxin-Cp3a | W5U5X5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Cheiracanthiidae Cheiracanthium | Cheiracanthium punctorium (Yellow sac spider) (Aranea punctoria) | 28 | toxin activity | 180 | Toxin CpTx-3a , Toxin CpTx1-3a | None | 682790 | extracellular region | None | 24717175 | 28 | 19:46 | ENVYDLQPESSEEENPGTFLEAIQEQSR | |
PSQ02138 | FND00144 | M-myrmicitoxin(01)-Tb1a | W8GNV3 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmicinae Tetramorium | Tetramorium bicarinatum (Tramp ant) | 30 | None | 79 | Ant peptide P16 , Bicarinalin , Bicarinaline , M-myrmicitoxin-Tb1a | None | 219812 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 22960382 | 30 | 27:56 | KAWADADADATAAADADADAVADALADAVA | |
PSQ02139 | FD00003 | Mu-conotoxin GVIIJ | X5IWS1 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium | Conus geographus (Geography cone) (Nubecula geographus) | 25 | ion channel inhibitor activity, toxin activity | 82 | Conotoxin muO-GVIIJ , MuO | None | 6491 | extracellular region | pathogenesis | 24497506 | 25 | 23:47 | LDCGGTQKHRALRSTIKLSLLRQHR | |
PSQ02140 | FND00259 | Alpha-conotoxin GVIIIB | X5IWT5 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium | Conus geographus (Geography cone) (Nubecula geographus) | 23 | toxin activity | 88 | AlphaS-conotoxin GVIIIB | None | 6491 | extracellular region, host cell postsynaptic membrane | None | 26074268 | 23 | 21:43 | QQEGDVQARKTRPKSDFYRALPR |