Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01115

ProSeqID PSQ01115
Family FD00109
Protein Name Neurotrophin-3
UniProt ID P20181
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 121
Functions chemoattractant activity, growth factor activity, nerve growth factor binding, nerve growth factor receptor binding, neurotrophin p75 receptor binding
Preproprotein Length (aa) 258
Alt Name HDNF, Nerve growth factor 2, Neurotrophic factor
Gene Name Ntf3
NCBI ID 10090
Cellular Localization axon, cytoplasmic vesicle, dendrite, endoplasmic reticulum lumen, extracellular region, extracellular space, synaptic vesicle
Processes activation of GTPase activity, activation of MAPK activity, activation of protein kinase B activity, axon guidance, brain development, enteric nervous system development, epidermis development, generation of neurons, glial cell fate determination, induction of positive chemotaxis, mechanoreceptor differentiation, memory, modulation of chemical synaptic transmission, myelination, negative regulation of neuron apoptotic process, negative regulation of peptidyl-tyrosine phosphorylation, nerve development, nerve growth factor signaling pathway, nervous system development, neuromuscular synaptic transmission, neuron development, neuron projection morphogenesis, peripheral nervous system development, positive regulation of actin cytoskeleton reorganization, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of glial cell differentiation, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of receptor internalization, positive regulation of transcription by RNA polymerase II, regulation of apoptotic process, regulation of neuron apoptotic process, regulation of neuron differentiation, smooth muscle cell differentiation, transmembrane receptor protein tyrosine kinase signaling pathway
PubMed 7957235
Total Prosequence Length (aa) 121
Prosequence Location 19:139
Prosequence Sequence NSMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPEQGEATRSEFQPMIATDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSPRRKR
Preproprotein Sequence MSILFYVIFLAYLRGIQGNSMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPEQGEATRSEFQPMIATDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSPRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT