Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00751 FD00239 Fibroblast growth factor 2 P03969 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 9 fibroblast growth factor receptor binding, growth factor activity, heparin binding, integrin binding 155 Basic fibroblast growth factor, Heparin-binding growth factor 2 FGF2 9913 cytoplasm, extracellular space, nucleus activation of MAPKK activity, angiogenesis, animal organ morphogenesis, branching involved in ureteric bud morphogenesis, cell differentiation, corticotropin hormone secreting cell differentiation, fibroblast growth factor receptor signaling pathway, glial cell differentiation, lung development, mammary gland epithelial cell differentiation, negative regulation of cell death, negative regulation of cell population proliferation, organ induction, positive regulation of angiogenesis, positive regulation of blood vessel endothelial cell migration, positive regulation of canonical Wnt signaling pathway, positive regulation of cell division, positive regulation of cell migration involved in sprouting angiogenesis, positive regulation of cell population proliferation, positive regulation of cerebellar granule cell precursor proliferation, positive regulation of endothelial cell migration, positive regulation of endothelial cell proliferation, positive regulation of epithelial cell proliferation, positive regulation of ERK1 and ERK2 cascade, positive regulation of gene expression, positive regulation of lens fiber cell differentiation, positive regulation of MAP kinase activity, positive regulation of osteoblast differentiation, positive regulation of protein kinase B signaling, positive regulation of protein phosphorylation, positive regulation of sprouting angiogenesis, positive regulation of transcription by RNA polymerase II, regulation of cell cycle, regulation of cell migration, regulation of retinal cell programmed cell death, response to axon injury, signal transduction, stem cell development, substantia nigra development, thyroid-stimulating hormone-secreting cell differentiation, wound healing 3741423, 3863109, 3940857 9 1:9 MAAGSITTL
PSQ00752 FD00169 Inhibin beta A chain P03970 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 288 cytokine activity, growth factor activity, hormone activity, identical protein binding, peptide hormone binding, type II activin receptor binding 424 Activin beta-A chain INHBA 9823 activin A complex, extracellular region, extracellular space, inhibin A complex, perinuclear region of cytoplasm activin receptor signaling pathway, cell cycle arrest, endodermal cell differentiation, extrinsic apoptotic signaling pathway, eyelid development in camera-type eye, G1/S transition of mitotic cell cycle, GABAergic neuron differentiation, hair follicle development, hematopoietic progenitor cell differentiation, hemoglobin biosynthetic process, male gonad development, mesodermal cell differentiation, negative regulation of cell cycle, negative regulation of cell growth, negative regulation of cell population proliferation, negative regulation of hair follicle development, odontogenesis, ovarian follicle development, positive regulation of erythrocyte differentiation, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of ovulation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, progesterone secretion, regulation of follicle-stimulating hormone secretion, regulation of transcription by RNA polymerase II, response to drug, roof of mouth development, SMAD protein signal transduction, striatal medium spiny neuron differentiation 1644823 288 21:308 SPTPGSGGHSAAPDCPSCALATLPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVELEDDIGRRAEMNELMEQTSEIITFAEAGTARKTLRFEISKEGSDLSVVERAEIWLFLKVPKANRTRTKVSIRLFQQQRRPQGSADAGEEAEDVGFPEEKSEVLISEKVVDARKSTWHIFPVSSSIQRLLDQGKSALDIRTACEQCHETGASLVLLGKKKKKEEEAEGRKRDGEGAGVDEEKEQSHRPFLMLQARQSEEHPHRRRRR
PSQ00753 FD00010 Phospholipase A2 P04054 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 7 bile acid binding, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), signaling receptor binding 148 Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B PLA2G1B 9606 cell surface, extracellular region, extracellular space, secretory granule actin filament organization, activation of MAPK activity, activation of phospholipase A2 activity, antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, arachidonic acid secretion, cellular response to insulin stimulus, defense response to Gram-positive bacterium, fatty acid biosynthetic process, innate immune response in mucosa, intracellular signal transduction, leukotriene biosynthetic process, lipid catabolic process, neutrophil chemotaxis, neutrophil mediated immunity, phosphatidic acid biosynthetic process, phosphatidylcholine acyl-chain remodeling, phosphatidylcholine metabolic process, phosphatidylethanolamine acyl-chain remodeling, phosphatidylglycerol acyl-chain remodeling, phosphatidylglycerol metabolic process, phosphatidylinositol acyl-chain remodeling, phosphatidylserine acyl-chain remodeling, positive regulation of calcium ion transport into cytosol, positive regulation of cell population proliferation, positive regulation of fibroblast proliferation, positive regulation of glomerular visceral epithelial cell apoptotic process, positive regulation of immune response, positive regulation of interleukin-8 production, positive regulation of NF-kappaB transcription factor activity, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, regulation of glucose import, signal transduction 6349696 7 16:22 DSGISPR
PSQ00754 FD00010 Phospholipase A2 P04055 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 7 bile acid binding, calcium ion binding, calcium-dependent phospholipase A2 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), signaling receptor binding 146 Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B Pla2g1b 10116 cell surface, extracellular region, extracellular space, secretory granule antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, arachidonic acid secretion, cellular response to insulin stimulus, defense response to Gram-positive bacterium, fatty acid biosynthetic process, innate immune response in mucosa, lipid catabolic process, phosphatidylcholine metabolic process, phosphatidylglycerol metabolic process, phospholipid metabolic process, positive regulation of cell population proliferation, positive regulation of fibroblast proliferation, positive regulation of glomerular visceral epithelial cell apoptotic process, regulation of glucose import 6501264 7 16:22 AHSISTR
PSQ00755 FD00004 Kallikrein 1-related peptidase b16 P04071 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 6 endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity 261 Gamma-renin, Glandular kallikrein K16 Klk1b16 10090 extracellular space, protein-containing complex, secretory granule regulation of systemic arterial blood pressure, zymogen activation 6337154 6 19:24 PPVQSR
PSQ00756 FD00272 Inhibin beta B chain P04088 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 264 growth factor activity, hormone activity, protein homodimerization activity 407 Activin beta-B chain INHBB 9823 extracellular region, perinuclear region of cytoplasm activin receptor signaling pathway, cellular response to insulin stimulus, cellular response to starvation, fat cell differentiation, negative regulation of follicle-stimulating hormone secretion, negative regulation of hepatocyte growth factor production, negative regulation of insulin secretion, positive regulation of follicle-stimulating hormone secretion, positive regulation of ovulation, response to wounding 1644823 264 29:292 SPTPPPSPAAPPPPPPPGALGGSQDTCTSCGGFRRPEELGRLDGDFLEAVKRHILNRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGRVEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEPGHGDRWDVVEKRVDLKRSGWHTLPLTEAIQALFERGERRLNLDVQCDGCQELAVVPVFVDPGEESHRPFVVVQARLVDSRHRIRKR
PSQ00757 FD00418 Cytochrome b5 type B P04166 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 11 electron transfer activity, enzyme activator activity, heme binding, metal ion binding, nitrite reductase (NO-forming) activity, ubiquinol-cytochrome-c reductase activity 146 Cytochrome b5 outer mitochondrial membrane isoform Cyb5b 10116 integral component of membrane, intracellular membrane-bounded organelle, membrane, mitochondrial outer membrane, nitric-oxide synthase complex nitric oxide biosynthetic process 6840088 11 1:11 MATPEASGSGR
PSQ00758 FD00258 Major prion protein P04273 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Cricetidae Cricetinae Mesocricetus Mesocricetus auratus (Golden hamster) 23 amyloid-beta binding, aspartic-type endopeptidase inhibitor activity, copper ion binding, cupric ion binding, glycosaminoglycan binding, identical protein binding, protease binding, protein-containing complex binding, signaling receptor activity, type 5 metabotropic glutamate receptor binding 254 PrP27-30, PrP33-35C PRNP 10036 anchored component of membrane, cell surface, cytosol, dendrite, endoplasmic reticulum, Golgi apparatus, membrane raft, nuclear membrane, plasma membrane, terminal bouton activation of protein kinase activity, calcium-mediated signaling using intracellular calcium source, cell cycle arrest, cellular response to amyloid-beta, cellular response to drug, learning or memory, modulation of age-related behavioral decline, negative regulation of activated T cell proliferation, negative regulation of amyloid-beta formation, negative regulation of apoptotic process, negative regulation of calcineurin-NFAT signaling cascade, negative regulation of dendritic spine maintenance, negative regulation of DNA-binding transcription factor activity, negative regulation of interferon-gamma production, negative regulation of interleukin-17 production, negative regulation of interleukin-2 production, negative regulation of protein phosphorylation, negative regulation of T cell receptor signaling pathway, neuron projection maintenance, positive regulation of neuron death, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of protein localization to plasma membrane, positive regulation of protein targeting to membrane, protein homooligomerization, regulation of calcium ion import across plasma membrane, regulation of glutamate receptor signaling pathway, regulation of potassium ion transmembrane transport, response to oxidative stress 1980209 23 232:254 SAVLFSSPPVILLISFLIFLMVG
PSQ00759 FD00028 2S sulfur-rich seed storage protein 1 P04403 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids Ericales Lecythidaceae Bertholletia Bertholletia excelsa (Brazil nut) 14 nutrient reservoir activity 146 None BE2S1 3645 None None 3758080 14 23:36 FRATVTTTVVEEEN
PSQ00760 FD00286 Pilin P04737 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 51 None 121 F-pilin traA 83333 extracellular region, integral component of membrane, plasma membrane conjugation 6090426 51 1:51 MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMA
PSQ00761 FD00102 Type IV major pilin protein PilA P04739 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 149 Pilin pilA 208964 cell surface, cytosol, host cell endoplasmic reticulum membrane, integral component of membrane, pilus, plasma membrane, type IV pilus cell adhesion involved in single-species biofilm formation, cell-cell adhesion, pathogenesis, regulation of calcium-mediated signaling, single-species biofilm formation on inanimate substrate, type IV pilus biogenesis, type IV pilus-dependent motility 1429457 6 1:6 MKAQKG
PSQ00762 FD00482 Carboxypeptidase E P04836 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 14 cell adhesion molecule binding, metallocarboxypeptidase activity, neurexin family protein binding, zinc ion binding 480 Carboxypeptidase H, Enkephalin convertase, Prohormone-processing carboxypeptidase CPE 9913 extracellular space, Golgi apparatus, secretory granule membrane, transport vesicle membrane cardiac left ventricle morphogenesis, insulin processing, peptide hormone secretion, peptide metabolic process, protein localization to membrane, protein localization to secretory granule, protein processing, Wnt signaling pathway 2396993 14 28:41 RGPGGPVAGARRRR
PSQ00763 FD00230 Serglycin P04917 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 49 collagen binding 180 Chondroitin sulfate proteoglycan core protein, Cytolytic granule proteoglycan core protein, PG19 core protein, Proteoglycan 10K core protein, Secretory granule proteoglycan core protein Srgn 10116 extracellular space, glutamatergic synapse, Golgi apparatus, mast cell granule, postsynaptic specialization, intracellular component, Schaffer collateral - CA1 synapse, secretory granule, zymogen granule apoptotic process, biomineral tissue development, granzyme-mediated programmed cell death signaling pathway, maintenance of granzyme B location in T cell secretory granule, maintenance of protease location in mast cell secretory granule, mast cell secretory granule organization, modulation of chemical synaptic transmission, negative regulation of bone mineralization, negative regulation of cytokine production, protein processing, regulation of postsynapse organization, secretory granule organization, T cell secretory granule organization 3919394 49 27:75 YPARRARYQWVRCKPDGIFANCIEEKGPRFDLIAEESNVGPPMTDPVLM
PSQ00764 FD00288 Polygalacturonase-2 P05117 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) 13 polygalacturonase activity 457 PG-2A, PG-2B, Pectinase PG2 4081 apoplast, cell wall anther dehiscence, cell wall organization, fruit dehiscence, fruit ripening, pectin catabolic process 16666031 13 445:457 LEISEDEALLYNY
PSQ00765 FD00461 Type-2 ice-structuring protein P05140 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Perciformes Cottioidei Cottales Agonidae Hemitripterinae Hemitripterus Hemitripterus americanus (Sea raven) 17 carbohydrate binding 163 Type II antifreeze protein None 8094 extracellular region None 2572595 17 18:34 NDDKILKGTATEAGPVS
PSQ00766 FD00055 Preprocaerulein type-1 P05222 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 144 hormone activity 188 Preprocaerulein type I None 8355 extracellular region defense response 5413288 144 27:170 DEERDVRGLASFLGKALKAGLKIGAHLLGGAPQQREANDERRFADDDDDVNERDVRGFASFLGKALKAALKIGANMLGGTPQQREANDERRFADDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00767 FD00055 Preprocaerulein type-3 P05224 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 46, 51 hormone activity 169 Preprocaerulein type III None 8355 extracellular region defense response 5413288;5413288 97 27:72, 101:151 DEERDVRGLASLLGKALKAGLKIGTHFLGGAPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGAPQQREANDERRFADG
PSQ00768 FND00335 Preprocaerulein clone PXC202 P05225 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 9, 51, 51, 22 hormone activity 187 None None 8355 extracellular region defense response 5413288;5413288;5413288;5413288 133 1:9, 23:73, 87:137, 166:187 NDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAALKIGANALGGSLQQREVNDERRFADG, DDEDDVHERDVRGFGSFLGKAL
PSQ00769 FD00055 Preprocaerulein type-4 P05226 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus borealis (Kenyan clawed frog) 47, 51, 51 hormone activity 240 Preprocaerulein type IV None 8354 extracellular region defense response 5413288;5413288;5413288 149 27:73, 87:137, 166:216 DEEERDVRGLASLLGKALKAALKIGANALGGSPQQREANDERRFADG, DDEDDVNERDVRGFGSFLGKALKAGLKIGTHFLGGAPQQREANDERRFADG, DDEDDVHERDVRGFGSFLGKALKAALKIGANALGGSPQQREANDERRFADG
PSQ00770 FD00003 Omega-conotoxin MVIIA P05484 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus Conus magus (Magus cone) (Magician 23 ion channel inhibitor activity, toxin activity 71 SNX-111 None 6492 extracellular region pathogenesis 2441741, 4071055 23 23:45 DDSRGTQKHRALRSTTKLSTSTR
PSQ00771 FD00007 Thrombin-like enzyme flavoxobin P05620 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) 6 serine-type endopeptidase activity, toxin activity 260 Fibrinogen-clotting enzyme, Habutobin, Snake venom serine protease 1 TLF1 88087 extracellular region None 12225369, 3170503 6 19:24 QKSSEL
PSQ00772 FD00049 Bacillolysin P05806 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus cereus 222 metal ion binding, metalloendopeptidase activity 566 Neutral protease npr 1396 extracellular region None 3092843 222 28:249 DSKNVLSTKKYNETVQSPEFISGDLTEATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKFNTIDHVTNDDKSPVKQEAPKQDAKAVVKP
PSQ00773 FND00219 Bacteriocin microcin B17 P05834 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 26 None 69 None mcbA 562 None cytolysis, defense response to bacterium, negative regulation of DNA replication 8183941 26 1:26 MELKASEFGVVLSVDALKLSRQSPLG
PSQ00774 FD00012 Papaya proteinase 4 P05994 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Caricaceae Carica Carica papaya (Papaya) 114 cysteine-type peptidase activity 348 Glycyl endopeptidase, Papaya peptidase B, Papaya proteinase IV None 3649 None None 2591528, 518921 114 19:132 GHMSLSYCDFSIVGYSQDDLTSTERLIQLFNSWMLKHNKNYKNVDEKLYRFEIFKDNLKYIDERNKMINGYWLGLNEFSDLSNDEFKEKYVGSLPEDYTNQPYDEEFVNEDIVD
PSQ00775 FD00094 Photosystem II CP43 reaction center protein P06003 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Chenopodiaceae Chenopodioideae Anserineae Spinacia Spinacia oleracea (Spinach) 14, 48 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, metal ion binding 480 PSII 43 kDa protein , Photosystem II 44 kDa chlorophyll apoprotein , Protein CP-43 psbC 3562 chloroplast thylakoid membrane, integral component of membrane, photosystem II photosynthetic electron transport in photosystem II, protein-chromophore linkage 3121625;3121625 62 1:14, 426:473 MKTLYSLRRFYPVE, LSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN
PSQ00776 FD00121 Rhizopuspepsin P06026 Eukaryota Fungi Fungi incertae sedis Mucoromycota Mucoromycotina Mucoromycetes Mucorales Mucorineae Rhizopodaceae Rhizopus Rhizopus chinensis (Bread mold) 47 aspartic-type endopeptidase activity 393 None None 4843 None None 3100534 47 22:68 APGEKKISIPLAKNPNYKPSAKNAIQKAIAKYNKHKINTSTGGIVPD
PSQ00777 FD00027 Ligninase H8 P06181 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Polyporales Phanerochaetaceae Phanerochaete Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) 7 diarylpropane peroxidase activity, heme binding, metal ion binding 372 Diarylpropane peroxidase, Lignin peroxidase LPOA 5306 None hydrogen peroxide catabolic process, lignin catabolic process, response to oxidative stress 2303054 7 22:28 AAVIEKR
PSQ00778 FD00137 RNA polymerase sigma-E factor P06222 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis (strain 168) 29 DNA binding, DNA-binding transcription factor activity, sigma factor activity 240 P31, Sigma-29, Stage II sporulation protein GB sigE 224308 None DNA-templated transcription, initiation, sporulation resulting in formation of a cellular spore 3104904 29 1:29 MKKLKLRLTHLWYKLLMKLGLKSDEVYYI
PSQ00779 FD00099 Renin-1 P06281 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 50 aspartic-type endopeptidase activity, endopeptidase activity, insulin-like growth factor receptor binding, peptidase activity, signaling receptor binding 402 Angiotensinogenase, Kidney renin Ren1 10090 apical part of cell, cytoplasm, extracellular space, membrane amyloid-beta metabolic process, angiotensin maturation, cell maturation, cellular response to drug, drinking behavior, hormone-mediated signaling pathway, kidney development, male gonad development, mesonephros development, proteolysis, regulation of blood pressure, regulation of blood volume by renin-angiotensin, regulation of MAPK cascade, renin-angiotensin regulation of aldosterone production, response to cAMP, response to cGMP, response to drug, response to immobilization stress, response to lipopolysaccharide, response to organic substance 9030738 50 22:71 LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLT
PSQ00780 FD00052 Corticoliberin P06296 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 124 corticotropin-releasing hormone activity 191 Corticotropin-releasing factor, Corticotropin-releasing hormone CRH 9823 extracellular space, synapse female pregnancy, inflammatory response, negative regulation of epinephrine secretion, negative regulation of glucagon secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, regulation of NMDA receptor activity, synaptic transmission, dopaminergic 3878520 124 25:148 LLSRGPVLGARQAPQHPQALDFLQPQQQPQQPQPRPVLLRMGEEYFLRLGNLNKSPAAPLSPASSPLTGSSGNRPDEVAANFFRALLQQLPLPRRPLDSPSGPAERGAENALSSRQEAPERERR
PSQ00781 FD00311 Major core protein 4b P06440 Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain, WR)) 61 None 643 Virion core protein 4b None 10254 virion None 1993877 61 1:61 MEAVVNSDVFLTSNAGLKSSYTNQTLSLVDEDHIHTSDKSLSCSVCNSLSQIVDDDFISAG
PSQ00782 FD00529 Binary larvicide subunit BinA P06575 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Lysinibacillus Lysinibacillus sphaericus (Bacillus sphaericus) 6 toxin activity 370 41, Binary paracrystalline larvicide subunit BinA binA 1421 spore wall pathogenesis, sporulation resulting in formation of a cellular spore 2886104 6 1:6 MRNLDF
PSQ00783 FD00093 Agglutinin P06750 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Euphorbiaceae Acalyphoideae Acalypheae Ricinus Ricinus communis (Castor bean) 12 carbohydrate binding, nucleotide binding, rRNA N-glycosylase activity, toxin activity 564 RCA None 3988 endoplasmic reticulum defense response, negative regulation of translation 6768555 12 291:302 SLLIRPVVPNFN
PSQ00784 FD00052 Corticoliberin P06850 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 129 corticotropin-releasing hormone activity, corticotropin-releasing hormone receptor 1 binding, corticotropin-releasing hormone receptor 2 binding, hormone activity, neuropeptide hormone activity, signaling receptor binding 196 Corticotropin-releasing factor, Corticotropin-releasing hormone CRH 9606 cytoplasm, extracellular region, extracellular space, perikaryon, synapse, varicosity associative learning, cellular response to cocaine, cellular response to dexamethasone stimulus, chemical synaptic transmission, diterpenoid metabolic process, female pregnancy, G protein-coupled receptor signaling pathway, hormone-mediated apoptotic signaling pathway, hypothalamus development, inflammatory response, ion homeostasis, learning or memory, long-term synaptic potentiation, negative regulation of cell death, negative regulation of circadian sleep/wake cycle, REM sleep, negative regulation of epinephrine secretion, negative regulation of gene expression, negative regulation of glucagon secretion, negative regulation of inflammatory response to antigenic stimulus, negative regulation of luteinizing hormone secretion, negative regulation of norepinephrine secretion, negative regulation of systemic arterial blood pressure, parturition, positive regulation of behavioral fear response, positive regulation of calcium ion import, positive regulation of cAMP-mediated signaling, positive regulation of cell death, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, wakefulness, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of cortisol secretion, positive regulation of digestive system process, positive regulation of gene expression, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of protein phosphorylation, regulation of NMDA receptor activity, regulation of serotonin secretion, response to corticosterone, response to drug, response to estrogen, response to ethanol, response to ether, response to immobilization stress, response to pain, signal transduction, steroid metabolic process, synaptic transmission, dopaminergic 3262120 129 25:153 LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERR
PSQ00785 FD00217 Beta-hexosaminidase subunit alpha P06865 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 66 acetylglucosaminyltransferase activity, beta-N-acetylhexosaminidase activity, N-acetyl-beta-D-galactosaminidase activity, protein heterodimerization activity 529 Beta-N-acetylhexosaminidase subunit alpha, N-acetyl-beta-glucosaminidase subunit alpha HEXA 9606 azurophil granule, cytosol, extracellular exosome, intracellular membrane-bounded organelle, lysosomal lumen, membrane carbohydrate metabolic process, chondroitin sulfate catabolic process, ganglioside catabolic process, glycosaminoglycan biosynthetic process, glycosphingolipid metabolic process, hyaluronan catabolic process, keratan sulfate catabolic process 2965147 66 23:88 LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRH
PSQ00786 FD00040 Thermostable neutral protease NprT P06874 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus stearothermophilus (Bacillus stearothermophilus) 204 metal ion binding, metalloendopeptidase activity 548 Stearolysin, Thermolysin-like protease nprT 1422 extracellular region None 2993245 204 26:229 KGESIVWNEQWKTPSFVSGSLLNGGEQALEELVYQYVDRENGTFRLGGRARDRLALIGKQTDELGHTVMRFEQRHHGIPVYGTMLAAHVKDGELIALSGSLIPNLDGQPRLKKAKTVTVQQAEAIAEQDVTETVTKERPTTENGERTRLVIYPTDGTARLAYEVNVRFLTPVPGNWVYIIDATDGAILNKFNQIDSRQPGGGQP
PSQ00787 FD00128 Cytochrome b-c1 complex subunit Rieske P07056 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Sordariales Sordariaceae Neurospora Neurospora crassa (strain ATCC 24698 , FGSC 987) 8 2 iron, 2 sulfur cluster binding, metal ion binding, oxidoreductase activity, ubiquinol-cytochrome-c reductase activity 238 Complex III subunit 5, Complex III subunit V , Rieske iron-sulfur protein, Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit, Ubiquinol-cytochrome c reductase complex 25 kDa protein fes-1 367110 integral component of membrane, mitochondrial respiratory chain complex III mitochondrial electron transport, ubiquinol to cytochrome c 3022944 8 25:32 LTTSTALQ
PSQ00788 FD00012 Procathepsin L P07154 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 96 aminopeptidase activity, collagen binding, cysteine-type carboxypeptidase activity, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, fibronectin binding, histone binding, kininogen binding, peptide binding, protein-containing complex binding, proteoglycan binding, serpin family protein binding 334 Cathepsin L1, Cyclic protein 2, Major excreted protein Ctsl 10116 apical plasma membrane, chromaffin granule, cytoplasm, cytoplasmic vesicle, external side of plasma membrane, extracellular space, lysosome, microvillus, multivesicular body, neuron projection, nucleolus, nucleus, perikaryon, plasma membrane, vacuole adaptive immune response, antigen processing and presentation of peptide antigen, autophagic cell death, CD4-positive, alpha-beta T cell lineage commitment, cell communication, cellular response to starvation, cellular response to thyroid hormone stimulus, collagen catabolic process, decidualization, elastin catabolic process, enkephalin processing, fusion of virus membrane with host endosome membrane, fusion of virus membrane with host plasma membrane, hair follicle morphogenesis, immune response, male gonad development, multicellular organism aging, negative regulation of keratinocyte proliferation, nerve development, protein autoprocessing, protein processing, proteolysis, proteolysis involved in cellular protein catabolic process, receptor-mediated endocytosis of virus by host cell, regulation of actin cytoskeleton reorganization, response to glucocorticoid, response to glucose, response to gonadotropin, response to odorant, response to organic cyclic compound, Sertoli cell differentiation, spermatogenesis, thyroid hormone generation, viral entry into host cell, zymogen activation 3402618 96 18:113 TPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQ
PSQ00789 FD00210 Aequorin-1 P07164 Eukaryota Metazoa Cnidaria Hydrozoa Hydroidolina Leptothecata Aequoreidae Aequorea Aequorea victoria (Jellyfish) 7 calcium ion binding 196 None None 6100 None bioluminescence 2866797 7 1:7 MTSEQYS
PSQ00790 FND00312 Xenopsin peptides P07198 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 9 None 81 None None 8355 extracellular region defense response to bacterium 4783175 9 65:73 EAMLRSAEA
PSQ00791 FD00265 Vitamin K-dependent protein S P07224 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 17 calcium ion binding 675 None PROS1 9913 extracellular space blood coagulation, fibrinolysis 2937785 17 25:41 NFLSRQHASQVLIRRRR
PSQ00792 FND00006 Conantokin-G P07231 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Gastridium Conus geographus (Geography cone) (Nubecula geographus) 59 metal ion binding, toxin activity 100 CGX-1007, Conotoxin GV , Sleeper peptide None 6491 extracellular region, host cell postsynaptic membrane pathogenesis 6501296 59 22:80 TGTLDDGGALTERRSADATALKAEPVLLQKSAARSTDDNGKDRLTQMKRILKQRGNKAR
PSQ00793 FD00095 Serralysin P07268 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia unclassified Serratia Serratia marcescens (strain ATCC 21074 16 calcium ion binding, metalloendopeptidase activity, zinc ion binding 487 Extracellular metalloproteinase, Serratiopeptidase, Zinc proteinase None 617 extracellular matrix, extracellular space proteolysis 6396298 16 1:16 MQSTKKAIEITESNFA
PSQ00794 FD00004 Prostate-specific antigen P07288 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 7 endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity, serine-type peptidase activity 261 Gamma-seminoprotein, Kallikrein-3, P-30 antigen, Semenogelase KLK3 9606 extracellular exosome, extracellular region, extracellular space, nucleus, protein-containing complex, secretory granule cellular protein metabolic process, negative regulation of angiogenesis, positive regulation of antibacterial peptide production, proteolysis, regulation of androgen receptor signaling pathway, regulation of systemic arterial blood pressure, zymogen activation 2422647, 3691515 7 18:24 APLILSR
PSQ00795 FD00527 Complement component C8 beta chain P07358 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 22 protein-containing complex binding 598 Complement component 8 subunit beta C8B 9606 extracellular exosome, extracellular region, extracellular vesicle, membrane, membrane attack complex complement activation, complement activation, alternative pathway, complement activation, classical pathway, cytolysis, immune response, regulation of complement activation 3651397 22 33:54 ERPHSFGSNAVNKSFAKSRQMR
PSQ00796 FD00016 Neutrophil antibiotic peptide NP-5 P07466 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 43 None 95 Microbicidal peptide NP-5 None 9986 extracellular space defense response to bacterium 3988726 43 20:62 ELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAG
PSQ00797 FD00016 Neutrophil antibiotic peptide NP-4 P07467 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 43 None 95 Microbicidal peptide NP-4 None 9986 extracellular space defense response to bacterium 3988726 43 20:62 ELHSGMADDGVDQQQPRAQDLDVAVYIKQDETSPLEVLGAKAG
PSQ00798 FD00115 Corticostatin 1 P07469 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 40 None 93 Antiadrenocorticotropin peptide I, Corticostatin I, Microbicidal peptide NP-3A, Neutrophil antibiotic peptide NP-3A None 9986 extracellular space defense response to bacterium 1311240, 2829194, 3988726 40 20:59 ELFSVNVDEVLDQQQPGSDQDLVIHLTGEESSALQVPDTK
PSQ00799 FD00410 Astacin P07584 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea Astacoidea Astacidae Astacus Astacus astacus (Noble crayfish) (Astacus fluviatilis) 34 aspartic-type peptidase activity, glutamic-type peptidase activity, metalloendopeptidase activity, peptidase activity, zinc ion binding 251 Crayfish small molecule proteinase None 6715 cortical granule, cytoplasm, plasma membrane cell adhesion, fertilization, negative regulation of binding of sperm to zona pellucida, positive regulation of protein processing, prevention of polyspermy 3548817 34 16:49 SPIIPEAARALYYNDGMFEGDIKLRAGRQPARVG
PSQ00800 FD00382 Decorin P07585 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 14 collagen binding, extracellular matrix binding, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding, protein N-terminus binding, RNA binding 360 Bone proteoglycan II, PG-S2, PG40 DCN 9606 collagen type VI trimer, collagen-containing extracellular matrix, extracellular region, extracellular space, Golgi lumen, lysosomal lumen aging, animal organ morphogenesis, chondroitin sulfate biosynthetic process, chondroitin sulfate catabolic process, dermatan sulfate biosynthetic process, extracellular matrix organization, kidney development, negative regulation of angiogenesis, negative regulation of endothelial cell migration, negative regulation of vascular endothelial growth factor signaling pathway, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan, placenta development, positive regulation of autophagy, positive regulation of macroautophagy, positive regulation of mitochondrial depolarization, positive regulation of mitochondrial fission, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of transcription by RNA polymerase II, response to lipopolysaccharide, response to mechanical stimulus, skeletal muscle tissue development, wound healing 2590169, 3597437 14 17:30 GPFQQRGLFDFMLE
Total Pages 43
Go to Lab Web Page