Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00755

ProSeqID PSQ00755
Family FD00004
Protein Name Kallikrein 1-related peptidase b16
UniProt ID P04071
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 6
Functions endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, serine-type endopeptidase activity
Preproprotein Length (aa) 261
Alt Name Gamma-renin, Glandular kallikrein K16
Gene Name Klk1b16
NCBI ID 10090
Cellular Localization extracellular space, protein-containing complex, secretory granule
Processes regulation of systemic arterial blood pressure, zymogen activation
PubMed 6337154
Total Prosequence Length (aa) 6
Prosequence Location 19:24
Prosequence Sequence PPVQSR
Preproprotein Sequence MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKDTMMKNA