Details of PSQ00758
| ProSeqID |
PSQ00758 |
| Family |
FD00258 |
| Protein Name |
Major prion protein |
| UniProt ID |
P04273
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Cricetidae-Cricetinae-Mesocricetus |
| Organisms |
Mesocricetus auratus (Golden hamster) |
| Prosequence Length (aa) |
23 |
| Functions |
amyloid-beta binding, aspartic-type endopeptidase inhibitor activity, copper ion binding, cupric ion binding, glycosaminoglycan binding, identical protein binding, protease binding, protein-containing complex binding, signaling receptor activity, type 5 metabotropic glutamate receptor binding |
| Preproprotein Length (aa) |
254 |
| Alt Name |
PrP27-30, PrP33-35C |
| Gene Name |
PRNP |
| NCBI ID |
10036 |
| Cellular Localization |
anchored component of membrane, cell surface, cytosol, dendrite, endoplasmic reticulum, Golgi apparatus, membrane raft, nuclear membrane, plasma membrane, terminal bouton |
| Processes |
activation of protein kinase activity, calcium-mediated signaling using intracellular calcium source, cell cycle arrest, cellular response to amyloid-beta, cellular response to drug, learning or memory, modulation of age-related behavioral decline, negative regulation of activated T cell proliferation, negative regulation of amyloid-beta formation, negative regulation of apoptotic process, negative regulation of calcineurin-NFAT signaling cascade, negative regulation of dendritic spine maintenance, negative regulation of DNA-binding transcription factor activity, negative regulation of interferon-gamma production, negative regulation of interleukin-17 production, negative regulation of interleukin-2 production, negative regulation of protein phosphorylation, negative regulation of T cell receptor signaling pathway, neuron projection maintenance, positive regulation of neuron death, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of protein localization to plasma membrane, positive regulation of protein targeting to membrane, protein homooligomerization, regulation of calcium ion import across plasma membrane, regulation of glutamate receptor signaling pathway, regulation of potassium ion transmembrane transport, response to oxidative stress |
| PubMed |
1980209
|
| Total Prosequence Length (aa) |
23 |
| Prosequence Location |
232:254 |
| Prosequence Sequence |
SAVLFSSPPVILLISFLIFLMVG |
| Preproprotein Sequence |
MANLSYWLLALFVAMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRSSAVLFSSPPVILLISFLIFLMVG |
