Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ00551 | FD00457 | Caspase A | G5EBM1 | Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis | Caenorhabditis elegans | 273 | cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis | 540 | None | csp-1 | 6239 | cytoplasm, germ cell nucleus | activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, execution phase of apoptosis, negative regulation of cellular response to manganese ion, positive regulation of apoptotic process involved in development, positive regulation of cellular response to gamma radiation, positive regulation of neuron apoptotic process, protein autoprocessing, protein processing | 9857046 | 273 | 1:273 | MVLKTIEDNCKSQFDDDLVEDFNNFQTTSSMSSSTTISTEDFNTIEIESTFEICRSGSYTEEPILGENDEFLIDFEMERFLKFLKDKTKQVEKRKEPFSQKEIYAVFQRRIKSELCIETVKKKFQPLLPNAIQTCEFDEETMIRMIYGAGIRIDSVDFWNRFTSKATISLDCYSRLISYSSDSLTLSGTHRSGFTYHWISTPPVTYHRTENKDPNIQEPSPVEFLDVQSSLGSSMKPPILDKPTKLDDPAETRHDCSYSLEEYDSQSRMPRTD | |
PSQ00552 | FND00109 | Crassipeptide cce9a | G8FZS4 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Turridae Turridrupa | Turridrupa cerithina (Sea snail) (Crassispira cerithina) | 30 | toxin activity | 60 | Cce9 | None | 1077925 | extracellular region | None | 21939682 | 30 | 1:30 | ADNHARVAGPRAVASGRYATEKAFLQMMTR | |
PSQ00553 | FD00232 | Ulvan lyase NLR42 | G8G2V6 | Bacteria Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae Nonlabens | Nonlabens ulvanivorans (Persicivirga ulvanivorans) | 85 | lyase activity, metal ion binding | 540 | None | None | 906888 | extracellular region | None | 28327560 | 85 | 450:534 | SVDSQQIASVGVYPNPTVDGFTISLDNISAEKVQIFNLLGMLVYEQKTNESSIHIDNMDNFDSGMYIISVTANDNKVYQTKLIVN | |
PSQ00554 | FD00237 | Lantibiotic macedovicin | H2A7G5 | Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus | Streptococcus macedonicus (strain ACA-DC 198) | 25 | signaling receptor binding | 60 | None | None | 1116231 | extracellular region | cytolysis, defense response to bacterium | 23122510 | 25 | 1:25 | MMNATENQIFVETVSDQELEMLIGG | |
PSQ00555 | FD00003 | Mu-conotoxin TsIIIA | H2BKS9 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Tesselliconus | Conus tessulatus (Tessellate cone) | 28 | ion channel inhibitor activity, toxin activity | 67 | None | None | 101317 | extracellular region | pathogenesis | 28219625 | 28 | 21:48 | VPLDGDQPADQPAERKQNEQHPLFDQKR | |
PSQ00556 | FD00160 | Acid beta-fructofuranosidase 1 | H2DF87 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Rosaceae Rosoideae Rosoideae incertae sedis Rosa | Rosa hybrid cultivar | 115 | sucrose alpha-glucosidase activity | 588 | Vacuolar invertase 1 | None | 128735 | integral component of membrane, vacuolar lumen | carbohydrate metabolic process | 27083698 | 115 | 1:115 | MDTSTSAYAPLPGEDPLFSGHPPASLRRSWKGFAVIFASVLFLLSLVGLIIHQGPQQPPDVMPDKQDEHHHPQSTTPASETTASWEPRGKALGVSAKSNPPVSDELSYNWTNAMF | |
PSQ00557 | FND00212 | Lariatin | H7C8I3 | Bacteria Actinobacteria Corynebacteriales Nocardiaceae Rhodococcus | Rhodococcus jostii | 26 | None | 46 | Class II lasso peptide , Lariat peptide , Ribosomally synthesized and post-translationally modified peptide | larA | 132919 | None | cytolysis, defense response to bacterium | 22388571 | 26 | 1:26 | MTSQPSKKTYNAPSLVQRGKFARTTA | |
PSQ00558 | FD00034 | Chassatide C2 | I0B6F2 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia | Chassalia chartacea | 20 | None | 77 | Cyclotide chaC2 | None | 510798 | None | cytolysis, defense response | 22467870 | 20 | 25:44 | SDTIKVPDLGKRLLMNRDPN | |
PSQ00559 | FND00217 | Chassatide C4 | I0B6F3 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia | Chassalia chartacea | 19, 7 | None | 78 | Cyclotide chaC4 | None | 510798 | None | defense response | 22467870;22467870 | 26 | 24:42, 72:78 | IVIMQDPDLGRKLIMNPAN, GLNPESI | |
PSQ00560 | FD00034 | Chassatide C7 | I0B6F4 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia | Chassalia chartacea | 35 | None | 64 | Cyclotide chaC7 | None | 510798 | None | defense response to Gram-negative bacterium, hemolysis in other organism | 22467870 | 35 | 1:35 | VLVASLVMLEAQSSDTIQVPDWGKRLLMNHDSNRV | |
PSQ00561 | FD00034 | Chassatide C8 | I0B6F5 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia | Chassalia chartacea | 21 | None | 75 | Cyclotide chaC8 | None | 510798 | None | defense response to Gram-negative bacterium, hemolysis in other organism | 22467870 | 21 | 25:45 | SDTIKAPDWGKRLLMNHDSDL | |
PSQ00562 | FD00034 | Chassatide C13 | I0B6G2 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Gentianales Rubiaceae Rubioideae Palicoureeae Chassalia | Chassalia chartacea | 20 | None | 77 | Cyclotide chaC13 | None | 510798 | None | defense response | 22467870 | 20 | 25:44 | SNTFQVPDLGKRLLMNRDPN | |
PSQ00563 | FD00469 | Hyaluronidase conohyal-Cn1 | I0CME7 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Pionoconus | Conus consors (Singed cone) | 15 | hyalurononglucosaminidase activity | 448 | Hyaluronoglucosaminidase | None | 101297 | extracellular region | carbohydrate metabolic process | 22412800 | 15 | 19:33 | LSLPNHDVKSATSSR | |
PSQ00564 | FD00046 | Fungal defensin micasin | I1T3C7 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae Microsporum | Arthroderma otae (Microsporum canis) | 22 | None | 81 | Fungal defensin-like peptide | None | 63405 | extracellular region | defense response to bacterium | 22586077 | 22 | 22:43 | APATNNAAVDAAADATPAVEKR | |
PSQ00565 | FD00234 | Ophiophagus venom factor | I2C090 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Ophiophagus | Ophiophagus hannah (King cobra) (Naja hannah) | 84, 279 | endopeptidase inhibitor activity, metal ion binding, toxin activity | 1641 | CVF-like, Complement C3 homolog | None | 8665 | extracellular space | complement activation, inflammatory response | 22561424;22561424 | 363 | 645:728, 981:1259 | RRRRSSVLLLDSKASKAAQFQDQDLRKCCEDSMHENPMGYTCEKRAKYIQEGDACKAAFLECCRYIKGILDENQWESGLFLPRN, HLIITPSGCGEQNMIRMTAPVIATYYLDTTEQWETLGRNHRNEAVKQIMTGYAQQMVYKKANHSYAAFTNRASSTWLTAYVVKVFAMATKMVAGISHEIICGGVRWLILNRQQPDGAFKENAPVLSGTMQGGIQGDESEVTVTAFTLVALLESKTICNDSVNSLDSSIKKATDYLLKKYEKLQRPYTTALTAYALAAADRLNDDRVLMAASTGKNRWEEYNAHTHNVEGTSYALLALLKMKKFDQTGPIVRWLTDQNFYGGTYGQTQATVMLFQALAEY | |
PSQ00566 | FD00051 | Dye-decolorizing peroxidase AauDyP1 | I2DBY1 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Auriculariales Auriculariaceae Auricularia | Auricularia auricula-judae (Judas ear fungus) (Tremella auricula-judae) | 39 | heme binding, metal ion binding, peroxidase activity | 509 | AjP I , Manganese-independent peroxidase I | dyp1 | 29892 | extracellular region | None | 23111597 | 39 | 23:61 | RSVAPRVADSPAAVTGTRKTSLLKNVAGLPPVPSAAQVA | |
PSQ00567 | FD00051 | Dye-decolorizing peroxidase | I2DBY2 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Auriculariales Exidiaceae Exidia | Exidia glandulosa (Black witch | 39 | heme binding, metal ion binding, peroxidase activity | 501 | None | dyp1 | 5219 | extracellular region | None | 23111597 | 39 | 22:60 | RNVVARASNPASVTGTRKVSLLKNVAGLPAVPTAQQVAV | |
PSQ00568 | FD00051 | Dye-decolorizing peroxidase | I2DBY3 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Mycenaceae Mycena | Mycena epipterygia (Yellow-stemmed mycena) | 42 | heme binding, metal ion binding, peroxidase activity | 526 | None | dyp1 | 230806 | extracellular region | None | 23111597 | 42 | 22:63 | ARPRSTNAPPRRRTPQPRRTTSLFINPPALPDLPTVQAVDKL | |
PSQ00569 | FD00591 | Halolysin | I3R794 | Archaea Euryarchaeota Stenosarchaea group Halobacteria Haloferacales Haloferacaceae Haloferax | Haloferax mediterranei (strain ATCC 33500 , 14739 | 89 | serine-type endopeptidase activity | 519 | Halophilic serine protease | hly | 523841 | extracellular region | None | 8645734 | 89 | 28:116 | TSATPGRSPGPKKDEILVGVTSTADSPRKAVADAVPGNAEIVHENETLSYAAVKFPSKAPKQARENFISAITKRDEVKYAEKNATHEAL | |
PSQ00570 | FND00354 | Omega-scoloptoxin(05)-Ssm1a | I6R1R5 | Eukaryota Metazoa Ecdysozoa Arthropoda Myriapoda Chilopoda Pleurostigmophora Scolopendromorpha Scolopendridae Scolopendra | Scolopendra subspinipes (Vietnamese centipede) | 22 | toxin activity | 129 | Omega-scoloptoxin-Ssm1a | None | 55038 | extracellular region | None | 22595790 | 22 | 25:46 | LKCVRCDGPMSNYDCKTTYPAA | |
PSQ00571 | FND00187 | Kappa-scoloptoxin(07)-Ssm2a | I6RA66 | Eukaryota Metazoa Ecdysozoa Arthropoda Myriapoda Chilopoda Pleurostigmophora Scolopendromorpha Scolopendridae Scolopendra | Scolopendra subspinipes (Vietnamese centipede) | 22 | toxin activity | 74 | Kappa-scoloptoxin-Ssm2a | None | 55038 | extracellular region | None | 22595790 | 22 | 20:41 | ATIDKPIPKPILREAIEEIEVN | |
PSQ00572 | FND00188 | Putative neurotoxin 1 | I6S3A5 | Eukaryota Metazoa Ecdysozoa Arthropoda Myriapoda Chilopoda Pleurostigmophora Scolopendromorpha Scolopendridae Scolopendra | Scolopendra subspinipes (Vietnamese centipede) | 21 | toxin activity | 77 | Putative neurotoxin 3 | None | 55038 | extracellular region | None | 22595790 | 21 | 26:46 | KDCKQECVKRYTKGDLTNFLK | |
PSQ00573 | FD00143 | Spexin prohormone 1 | I7C2V3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Ostariophysi Cypriniformes Cyprinidae Cyprininae Carassius | Carassius auratus (Goldfish) | 9 | neuropeptide hormone activity, type 2 galanin receptor binding, type 3 galanin receptor binding | 102 | Spexin hormone | spx | 7957 | extracellular space, transport vesicle | long-chain fatty acid import into cell, negative regulation of appetite, negative regulation of heart rate, negative regulation of renal sodium excretion, positive regulation of systemic arterial blood pressure, positive regulation of transcription by RNA polymerase II, regulation of sensory perception of pain | 23715729 | 9 | 27:35 | APMGSFQRR | |
PSQ00574 | FD00103 | Phospholipase A(2) | I7GQA7 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Xylocopa Alloxylocopa | Xylocopa appendiculata circumvolans (Japanese carpenter bee) | 18 | metal ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine) | 180 | Phosphatidylcholine 2-acylhydrolase | PLA2 | 135722 | extracellular region | arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process | 28546807 | 18 | 22:39 | WMTYRSANGLDEYEPEDR | |
PSQ00575 | FD00002 | Dermaseptin-1 | J7H8J4 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus nordestinus (Northeastern Brazilian leaf frog) (Phyllomedusa, nordestina) | 21 | None | 73 | None | None | 2034992 | extracellular region | defense response to bacterium | 24113627 | 21 | 23:43 | EEEKRENEGEEEQEDDEQSEM | |
PSQ00576 | FD00255 | Polytheonamide B | J9ZXD8 | Bacteria | Bacterium symbiont subsp | 96 | catalytic activity, transition metal ion binding | 145 | Proteusin | poyA | 1221190 | None | defense response to bacterium, nitrogen compound metabolic process | 22983711 | 96 | 1:96 | MADSDNTPTSRKDFETAIIAKAWKDPEYLRRLRSNPREVLQEELEALHPGAQLPDDLGISIHEEDENHVHLVMPRHPQNVSDQTLTDDDLDQAAGG | |
PSQ00577 | FD00450 | Bottromycin D | K4JY29 | Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces | Streptomyces sp | 37 | None | 46 | None | bstA | 1931 | extracellular region | defense response to bacterium | 22984777 | 37 | 10:46 | MTADFLNDDPNNAELSSLEMEELESWGAWSDDTDQSV | |
PSQ00578 | FD00004 | Thrombin-like enzyme barnettobin | K4LLQ2 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops barnetti (Barnett | 6 | serine-type endopeptidase activity, toxin activity | 249 | Snake venom serine protease | None | 1051630 | extracellular region | None | 23578498 | 6 | 11:16 | HKSSEL | |
PSQ00579 | FD00033 | Alpha-conotoxin TxIB | K4RNX9 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder | Conus textile (Cloth-of-gold cone) | 20 | acetylcholine receptor inhibitor activity, toxin activity | 41 | None | None | 6494 | extracellular region, host cell postsynaptic membrane | pathogenesis | 23184959 | 20 | 1:20 | FDGRNTSANNKATDLMALPV | |
PSQ00580 | FND00117 | U1-theraphotoxin-Sp1a | K7N5K9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Selenotypus | Selenotypus plumipes (Australian featherleg tarantula) | 36 | toxin activity | 94 | Orally active insecticidal peptide 1 | None | 1395661 | extracellular region | None | 24039872 | 36 | 23:58 | DTEDADLMEMVQLSRPFFNPIIRAVELVELREERQR | |
PSQ00581 | FD00048 | Osteocalcin 2 | K7NTD0 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Spariformes Sparidae Diplodus | Diplodus sargus (White seabream) | 191 | calcium ion binding | 256 | Bone Gla protein , Gamma-carboxyglutamic acid-containing protein | bglap2 | 38941 | extracellular region | biomineral tissue development, bone development, regulation of cellular response to insulin stimulus, response to vitamin K | 24185858 | 191 | 19:209 | MGAVEPEVVVDTVADTTADAAPADPAAAAAPSSSSSESSESSESSESSESSESSESSESSESNSSSASDSNSSSDSSASDSNSSSDSSSSSSSSSSSSSSSSSSSESTESSESSESSSSSSSSSSSSSSSSSSSSSESSSSESNSADSSASDSPSSSSSSSSSSSSESASDEAAKVVVKRDLASVLLRRRR | |
PSQ00582 | FND00070 | Osteocalcin 2b | K9J977 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Protacanthopterygii Salmoniformes Salmonidae Salmoninae Oncorhynchus | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) | 97 | calcium ion binding | 164 | Bone Gla protein , Gamma-carboxyglutamic acid-containing protein | None | 8022 | extracellular region | biomineral tissue development, bone development, regulation of cellular response to insulin stimulus, response to vitamin K | 24185858 | 97 | 19:115 | MNDLALDVVLDPDPAAEPAPAADSSASSSASSSSSSASDSSASASDSSDSDSSSSSSSSSSSESASAEAMAEDPAAATEPEVIMKRDLASVLLRRKR | |
PSQ00583 | FND00141 | Frenatin 2 | L0L3V3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Dendropsophini Sphaenorhynchus | Sphaenorhynchus lacteus (Orinoco lime treefrog) (Hyla lactea) | 32 | DNA binding | 71 | None | None | 279984 | extracellular region | defense response to bacterium, innate immune response, regulation of defense response to virus | 24704757 | 32 | 23:54 | EREKREEEEEEEEENKEEEANEEGKGESEEKR | |
PSQ00584 | FND00257 | Senegalin | L0P323 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Microhyloidea Hyperoliidae Kassina | Kassina senegalensis (Senegal running frog) | 33 | None | 76 | None | None | 8415 | extracellular region | defense response to bacterium, defense response to fungus, killing of cells of other organism | 23430307 | 33 | 23:55 | NKRSDGKRADEEGEDKRADEEGEDKRADEEGED | |
PSQ00585 | FD00002 | Medusin-C1 | L0P329 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) | 27 | None | 68 | Medusin-AC , Phyllin-AC | None | 197464 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 23415652 | 27 | 23:49 | EEEKRESEEEKNEQEEDDREERSEEKR | |
PSQ00586 | FND00022 | Medusin-DA1 | L0P3K3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) | 26 | None | 68 | Medusin-PD , Phyllin-PD | None | 75988 | extracellular region | defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism | 23415652 | 26 | 23:48 | EEEKRENEEEKNEQEEDDREERNEEK | |
PSQ00587 | FND00022 | Medusin-H1 | L0P402 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 26 | None | 67 | Medusin-PH , Phyllin-PH | None | 317381 | extracellular region | defense response to bacterium, defense response to fungus, hemolysis in other organism, innate immune response | 23415652 | 26 | 23:48 | EEEKRETEEKENEQEDDREERREEKR | |
PSQ00588 | FD00002 | [Thr6]-bradykinyl-Val,Asp | L0PIN3 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) | 28 | B1 bradykinin receptor binding, B2 bradykinin receptor binding, toxin activity | 61 | Bradykinin-related peptide RD-11 | None | 75988 | extracellular region | defense response, negative regulation of artery smooth muscle contraction, positive regulation of small intestine smooth muscle contraction, positive regulation of smooth muscle contraction involved in micturition, positive regulation of uterine smooth muscle contraction, vasodilation | 24394432 | 28 | 23:50 | EEEKREDEEEENEREENKESEEKRNQEE | |
PSQ00589 | FND00010 | [Thr6]-bradykinyl-Val,Asp | L0PJV8 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas) | 28 | B1 bradykinin receptor binding, B2 bradykinin receptor binding, toxin activity | 61 | Bradykinin-related peptide RD-11 | None | 197464 | extracellular region | defense response, negative regulation of artery smooth muscle contraction, positive regulation of small intestine smooth muscle contraction, positive regulation of smooth muscle contraction involved in micturition, positive regulation of uterine smooth muscle contraction, vasodilation | 24394432 | 28 | 23:50 | EEEKRETEEEENEDEMDKESEEKRESPE | |
PSQ00590 | FD00011 | Subtilisin-like protease 2 | L8FSM5 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Leotiomycetes Leotiomycetes incertae sedis Pseudeurotiaceae Pseudogymnoascus | Pseudogymnoascus destructans (strain ATCC MYA-4855 , white-nose syndrome fungus) (Geomyces destructans) | 99 | serine-type endopeptidase activity | 400 | Destructin-1 , Serine protease 2 | SP2 | 658429 | extracellular region | None | 25944934 | 99 | 21:119 | APEEAQHAKIRSPGAQDIILDSYIVVFNKGVNDADIESEFASVSHILSKRRPAHKGVGHKYNITGFKGYQIETDTGSIGEIAASPLVAWIERDGKVQAN | |
PSQ00591 | FD00011 | Subtilisin-like protease 1 | L8G6I7 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Leotiomycetes Leotiomycetes incertae sedis Pseudeurotiaceae Pseudogymnoascus | Pseudogymnoascus destructans (strain ATCC MYA-4855 , white-nose syndrome fungus) (Geomyces destructans) | 99 | serine-type endopeptidase activity | 400 | Destructin-2 , Serine protease 1 | SP1 | 658429 | extracellular region | None | 25785714 | 99 | 21:119 | APVEAQHAKIRSPRAQDIIPDSYIVVFNKGVNDADIESEFSSVSRILSKRRSAHKGVGHKYNITGFKGYQIETDTGSIGEIAASPLVAWIEMDGKVQAN | |
PSQ00592 | FND00297 | U2-sicaritoxin-Sdo1a | M1E1F0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Scytodoidea Sicariidae Sicarius | Hexophthalma dolichocephala (Afrotropical spider) (Sicarius, dolichocephalus) | 19 | None | 74 | S67 , U2-sicaritoxin-Sd1a | None | 571538 | extracellular region | None | 23342149 | 19 | 21:39 | RINPNQLKRLRELVRDDEP | |
PSQ00593 | FND00284 | U1-sicaritoxin-Sdo1a | M1E1F1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Scytodoidea Sicariidae Sicarius | Hexophthalma dolichocephala (Afrotropical spider) (Sicarius, dolichocephalus) | 17 | None | 72 | S64 , U1-sicaritoxin-Sd1a | None | 571538 | extracellular region | None | 23342149 | 17 | 25:41 | EKFHKMKSDIERDETPM | |
PSQ00594 | FND00271 | Tachykinin-like peptide | M9P2C1 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Rhacophoridae Rhacophorinae Theloderma | Theloderma corticale (Kwangsi warty tree frog) (Theloderma kwangsiense) | 32, 26 | None | 91 | Tachykinin-Thel | None | 126966 | extracellular region | defense response, neuropeptide signaling pathway, tachykinin receptor signaling pathway | 23829212;23829212 | 58 | 20:51, 66:91 | AEIGLNDEPEWYSDQIQEDLPVFENFLQRIAR, NNGFGQMSRKRSAERNTIHNYERRRK | |
PSQ00595 | FD00425 | Agouti-related protein | O00253 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 62 | melanocortin receptor binding, neuropeptide hormone activity, signaling receptor binding, type 1 melanocortin receptor binding | 132 | None | AGRP | 9606 | extracellular space, Golgi lumen, neuronal cell body | adult feeding behavior, circadian rhythm, eating behavior, feeding behavior, hormone-mediated signaling pathway, long-day photoperiodism, maternal process involved in female pregnancy, neuropeptide signaling pathway, positive regulation of feeding behavior, regulation of feeding behavior, response to insulin | 16384863, 17185225 | 62 | 21:82 | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR | |
PSQ00596 | FD00131 | Caspase-1 | O02002 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora | Drosophila melanogaster (Fruit fly) | 13 | BIR domain binding, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in execution phase of apoptosis | 323 | None | Dcp-1 | 7227 | cytoplasm, cytosol, messenger ribonucleoprotein complex, mitochondrion, neuronal cell body, neuronal ribonucleoprotein granule | apoptotic process, cellular response to starvation, cytoplasmic transport, nurse cell to oocyte, execution phase of apoptosis, multicellular organism development, negative regulation of apoptotic process, negative regulation of neuromuscular synaptic transmission, neuron remodeling, nurse cell apoptotic process, oogenesis, ovarian nurse cell to oocyte transport, positive regulation of autophagy, positive regulation of macroautophagy, programmed cell death, programmed cell death involved in cell development | 8999799 | 13 | 203:215 | GGITLEKGVTETD | |
PSQ00597 | FD00164 | Anionic peroxidase | O04795 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Convolvulaceae Ipomoeeae Ipomoea | Ipomoea batatas (Sweet potato) (Convolvulus batatas) | 46 | heme binding, metal ion binding, peroxidase activity | 364 | SwPA1 | None | 4120 | extracellular region | hydrogen peroxide catabolic process, response to oxidative stress | 9267434 | 46 | 21:66 | GCAVYQNTQTAMKDQLKVTPTWLDNTLKSTNLLSLGLGKPSGGKLG | |
PSQ00598 | FD00164 | Neutral peroxidase | O04796 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Convolvulaceae Ipomoeeae Ipomoea | Ipomoea batatas (Sweet potato) (Convolvulus batatas) | 47 | heme binding, metal ion binding, peroxidase activity | 348 | SwPN1 | None | 4120 | extracellular region | hydrogen peroxide catabolic process, response to oxidative stress | 9267434 | 47 | 21:67 | GYSLVQNTLSSPTHTRLNLIPTWLDSTFDSADVLSYLGFGKSSGRLS | |
PSQ00599 | FD00250 | Subtilosin-A | O07623 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus subtilis (strain 168) | 8 | None | 43 | Antilisterial bacteriocin subtilosin | sboA | 224308 | extracellular region | cytolysis, defense response to bacterium | 3936839 | 8 | 1:8 | MKKAVIVE | |
PSQ00600 | FD00104 | Regenerating islet-derived protein 3-gamma | O09049 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 11 | oligosaccharide binding, peptidoglycan binding, signaling receptor activity | 180 | Pancreatitis-associated protein 3, Regenerating islet-derived protein III-gamma | Reg3g | 10090 | collagen-containing extracellular matrix, extracellular region, secretory granule | acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, cell wall disruption in other organism, cytolysis by host of symbiont cells, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, MyD88-dependent toll-like receptor signaling pathway, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to bacterium, response to peptide hormone | 19095652 | 11 | 27:37 | EVAKKDAPSSR |