Details of PSQ00779
| ProSeqID |
PSQ00779 |
| Family |
FD00099 |
| Protein Name |
Renin-1 |
| UniProt ID |
P06281
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus |
| Organisms |
Mus musculus (Mouse) |
| Prosequence Length (aa) |
50 |
| Functions |
aspartic-type endopeptidase activity, endopeptidase activity, insulin-like growth factor receptor binding, peptidase activity, signaling receptor binding |
| Preproprotein Length (aa) |
402 |
| Alt Name |
Angiotensinogenase, Kidney renin |
| Gene Name |
Ren1 |
| NCBI ID |
10090 |
| Cellular Localization |
apical part of cell, cytoplasm, extracellular space, membrane |
| Processes |
amyloid-beta metabolic process, angiotensin maturation, cell maturation, cellular response to drug, drinking behavior, hormone-mediated signaling pathway, kidney development, male gonad development, mesonephros development, proteolysis, regulation of blood pressure, regulation of blood volume by renin-angiotensin, regulation of MAPK cascade, renin-angiotensin regulation of aldosterone production, response to cAMP, response to cGMP, response to drug, response to immobilization stress, response to lipopolysaccharide, response to organic substance |
| PubMed |
9030738
|
| Total Prosequence Length (aa) |
50 |
| Prosequence Location |
22:71 |
| Prosequence Sequence |
LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLT |
| Preproprotein Sequence |
MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR |
