Details of PSQ00788
| ProSeqID |
PSQ00788 |
| Family |
FD00012 |
| Protein Name |
Procathepsin L |
| UniProt ID |
P07154
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
96 |
| Functions |
aminopeptidase activity, collagen binding, cysteine-type carboxypeptidase activity, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, fibronectin binding, histone binding, kininogen binding, peptide binding, protein-containing complex binding, proteoglycan binding, serpin family protein binding |
| Preproprotein Length (aa) |
334 |
| Alt Name |
Cathepsin L1, Cyclic protein 2, Major excreted protein |
| Gene Name |
Ctsl |
| NCBI ID |
10116 |
| Cellular Localization |
apical plasma membrane, chromaffin granule, cytoplasm, cytoplasmic vesicle, external side of plasma membrane, extracellular space, lysosome, microvillus, multivesicular body, neuron projection, nucleolus, nucleus, perikaryon, plasma membrane, vacuole |
| Processes |
adaptive immune response, antigen processing and presentation of peptide antigen, autophagic cell death, CD4-positive, alpha-beta T cell lineage commitment, cell communication, cellular response to starvation, cellular response to thyroid hormone stimulus, collagen catabolic process, decidualization, elastin catabolic process, enkephalin processing, fusion of virus membrane with host endosome membrane, fusion of virus membrane with host plasma membrane, hair follicle morphogenesis, immune response, male gonad development, multicellular organism aging, negative regulation of keratinocyte proliferation, nerve development, protein autoprocessing, protein processing, proteolysis, proteolysis involved in cellular protein catabolic process, receptor-mediated endocytosis of virus by host cell, regulation of actin cytoskeleton reorganization, response to glucocorticoid, response to glucose, response to gonadotropin, response to odorant, response to organic cyclic compound, Sertoli cell differentiation, spermatogenesis, thyroid hormone generation, viral entry into host cell, zymogen activation |
| PubMed |
3402618
|
| Total Prosequence Length (aa) |
96 |
| Prosequence Location |
18:113 |
| Prosequence Sequence |
TPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQ |
| Preproprotein Sequence |
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN |
