Details of PSQ00763
| ProSeqID |
PSQ00763 |
| Family |
FD00230 |
| Protein Name |
Serglycin |
| UniProt ID |
P04917
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
49 |
| Functions |
collagen binding |
| Preproprotein Length (aa) |
180 |
| Alt Name |
Chondroitin sulfate proteoglycan core protein, Cytolytic granule proteoglycan core protein, PG19 core protein, Proteoglycan 10K core protein, Secretory granule proteoglycan core protein |
| Gene Name |
Srgn |
| NCBI ID |
10116 |
| Cellular Localization |
extracellular space, glutamatergic synapse, Golgi apparatus, mast cell granule, postsynaptic specialization, intracellular component, Schaffer collateral - CA1 synapse, secretory granule, zymogen granule |
| Processes |
apoptotic process, biomineral tissue development, granzyme-mediated programmed cell death signaling pathway, maintenance of granzyme B location in T cell secretory granule, maintenance of protease location in mast cell secretory granule, mast cell secretory granule organization, modulation of chemical synaptic transmission, negative regulation of bone mineralization, negative regulation of cytokine production, protein processing, regulation of postsynapse organization, secretory granule organization, T cell secretory granule organization |
| PubMed |
3919394
|
| Total Prosequence Length (aa) |
49 |
| Prosequence Location |
27:75 |
| Prosequence Sequence |
YPARRARYQWVRCKPDGIFANCIEEKGPRFDLIAEESNVGPPMTDPVLM |
| Preproprotein Sequence |
MRQVPVGTRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPDGIFANCIEEKGPRFDLIAEESNVGPPMTDPVLMRGFPNDFFPISDDYSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSLADMEWEYQPTDENNIVYFNYGPFDRMLTEQNQEQPGDFII |
