Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00801 FND00291 Heat-stable enterotoxin A P07593 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia enterocolitica 34 toxin activity 71 YST-A ystA 630 extracellular space pathogenesis 4043080 34 20:53 QETVSGQFSDALSTPITAEVYKQACDPPLPPAEV
PSQ00802 FD00462 Fimbrial protein Q P07640 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Moraxella Moraxella bovis 6 None 157 Beta pilin, Q pilin tfpQ 476 pilus, type II protein secretion system complex cell adhesion, protein secretion by the type II secretion system 2902184 6 1:6 MNAQKG
PSQ00803 FD00007 Submandibular glandular kallikrein-9 P07647 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 6 serine-type endopeptidase activity 259 KLK-S3, S3 kallikrein, Submandibular enzymatic vasoconstrictor, Tissue kallikrein Klk9 10116 secretory granule positive regulation of vasoconstriction, regulation of systemic arterial blood pressure, zymogen activation 1315752, 1536657, 1900513 6 19:24 PPGQSR
PSQ00804 FD00108 Glutaryl-7-aminocephalosporanic-acid acylase P07662 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas sp 9 glutaryl-7-aminocephalosporanic-acid acylase activity 720 7-beta-(4-carboxybutanamido)cephalosporanic acid acylase, GL-7-ACA acylase None 269086 periplasmic space antibiotic biosynthetic process, response to antibiotic 2993240 9 190:198 DPPDLADQG
PSQ00805 FD00217 Beta-hexosaminidase subunit beta P07686 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 79 acetylglucosaminyltransferase activity, beta-N-acetylhexosaminidase activity, identical protein binding, N-acetyl-beta-D-galactosaminidase activity 556 Beta-N-acetylhexosaminidase subunit beta, Cervical cancer proto-oncogene 7 protein, N-acetyl-beta-glucosaminidase subunit beta HEXB 9606 acrosomal vesicle, azurophil granule, azurophil granule lumen, cortical granule, extracellular exosome, extracellular region, lysosomal lumen, membrane astrocyte cell migration, cellular calcium ion homeostasis, cellular protein metabolic process, chondroitin sulfate catabolic process, ganglioside catabolic process, glycosphingolipid metabolic process, hyaluronan catabolic process, keratan sulfate catabolic process, lipid storage, locomotory behavior, lysosome organization, male courtship behavior, myelination, neuromuscular process controlling balance, neutrophil degranulation, oligosaccharide catabolic process, oogenesis, penetration of zona pellucida, phospholipid biosynthetic process, positive regulation of transcription by RNA polymerase II, regulation of cell shape, sensory perception of sound, single fertilization, skeletal system development 2965147, 2966076 79 43:121 ARAPSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQAK
PSQ00806 FD00012 Procathepsin L P07711 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 96 collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, fibronectin binding, histone binding, proteoglycan binding, serpin family protein binding 333 Cathepsin L1 , Major excreted protein CTSL 9606 apical plasma membrane, chromaffin granule, collagen-containing extracellular matrix, endocytic vesicle lumen, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosomal lumen, lysosome, multivesicular body, nucleus, plasma membrane adaptive immune response, antigen processing and presentation, antigen processing and presentation of exogenous peptide antigen via MHC class II, antigen processing and presentation of peptide antigen, CD4-positive, alpha-beta T cell lineage commitment, cellular response to thyroid hormone stimulus, collagen catabolic process, elastin catabolic process, enkephalin processing, extracellular matrix disassembly, fusion of virus membrane with host endosome membrane, fusion of virus membrane with host plasma membrane, immune response, macrophage apoptotic process, protein autoprocessing, proteolysis, proteolysis involved in cellular protein catabolic process, receptor-mediated endocytosis of virus by host cell, regulation of keratinocyte differentiation, toll-like receptor signaling pathway, viral entry into host cell, zymogen activation 9468501 96 18:113 TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYE
PSQ00807 FD00440 Protein decapentaplegic P07713 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 433 BMP receptor binding, collagen binding, cytokine activity, growth factor activity, heparin binding, morphogen activity, protein heterodimerization activity, protein homodimerization activity, receptor ligand activity 588 None dpp 7227 cell leading edge, dense core granule lumen, extracellular space amnioserosa formation, anterior Malpighian tubule development, BMP signaling pathway, cardioblast differentiation, cell chemotaxis involved in Malpighian tubule morphogenesis, chorion-containing eggshell formation, compound eye morphogenesis, dorsal appendage formation, dorsal closure, dorsal/ventral axis specification, dorsal/ventral pattern formation, ectodermal cell fate specification, embryonic hindgut morphogenesis, epithelial cell migration, open tracheal system, eye-antennal disc development, eye-antennal disc morphogenesis, female germ-line stem cell population maintenance, fusion cell fate specification, genital disc anterior/posterior pattern formation, genital disc development, genital disc sexually dimorphic development, germ cell development, germ cell migration, germ-line stem cell division, germ-line stem cell population maintenance, head morphogenesis, heart development, hemocyte development, hindgut morphogenesis, imaginal disc development, imaginal disc-derived wing morphogenesis, imaginal disc-derived wing vein morphogenesis, imaginal disc-derived wing vein specification, labial disc development, larval lymph gland hemocyte differentiation, lymph gland development, male germ-line stem cell population maintenance, Malpighian tubule morphogenesis, maternal specification of dorsal/ventral axis, oocyte, soma encoded, mesoderm development, negative regulation of gene expression, negative regulation of salivary gland boundary specification, ovarian follicle cell development, pericardial nephrocyte differentiation, positive regulation of gene expression, positive regulation of imaginal disc growth, positive regulation of muscle organ development, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of SMAD protein signal transduction, progression of morphogenetic furrow involved in compound eye morphogenesis, R8 cell fate specification, regulation of cell differentiation, regulation of cell shape, regulation of imaginal disc growth, regulation of stem cell differentiation, regulation of tube diameter, open tracheal system, SMAD protein signal transduction, spectrosome organization, wing and notum subfield formation, wing disc pattern formation, zygotic specification of dorsal/ventral axis 1692958 433 24:456 EDISQRFIAAIAPVAAHIPLASASGSGSGRSGSRSVGASTSTALAKAFNPFSEPASFSDSDKSHRSKTNKKPSKSDANRQFNEVHKPRTDQLENSKNKSKQLVNKPNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTESHQSSSIESIFVEEPTLVLDREVASINVPANAKAIIAEQGPSTYSKEALIKDKLKPDPSTLVEIEKSLLSLFNMKRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSFTHKDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRYQVLVYDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLVEVRTVRSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIR
PSQ00808 FD00316 Photosystem II protein D1 1 P07826 Bacteria Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp 16 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, iron ion binding, oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor, oxygen evolving activity 360 Photosystem II Q(B) protein 1 psbA1 1111708 integral component of membrane, photosystem II, plasma membrane-derived thylakoid membrane photosynthetic electron transport in photosystem II, protein-chromophore linkage, response to herbicide 8034700 16 345:360 SGDAQMVALNAPAIEG
PSQ00809 FD00082 Cathepsin B P07858 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 62 collagen binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, peptidase activity, proteoglycan binding 339 APP secretase, Cathepsin B1 CTSB 9606 apical plasma membrane, collagen-containing extracellular matrix, endolysosome lumen, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular anatomical structure, lysosome, melanosome, perinuclear region of cytoplasm cellular response to thyroid hormone stimulus, collagen catabolic process, epithelial cell differentiation, neutrophil degranulation, proteolysis, proteolysis involved in cellular protein catabolic process, regulation of apoptotic process, regulation of catalytic activity, toll-like receptor signaling pathway 3972105 62 18:79 RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLK
PSQ00810 FD00156 Penicillin G acylase P07941 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Kluyvera Kluyvera cryocrescens (Kluyvera citrophila) 54 metal ion binding, penicillin amidase activity 844 Penicillin G amidase, Penicillin amidohydrolase pac 580 periplasmic space antibiotic biosynthetic process, response to antibiotic 1764029 54 236:289 ALLVPRYDQPAPMLDRPAKGTDGALLAVTAIKNRETIAAQFANGANGLAGYPTT
PSQ00811 FND00206 Heat-stable enterotoxin A3 P07965 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli 34 toxin activity 72 ST-H, ST-IB, STA3 sta3 562 extracellular space pathogenesis 6759126 34 20:53 QDAKPVESSKEKITLESKKCNIAKKSNKSGPESM
PSQ00812 FD00128 Cytochrome b-c1 complex subunit Rieske P08067 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 8 2 iron, 2 sulfur cluster binding, metal ion binding, oxidoreductase activity, ubiquinol-cytochrome-c reductase activity 215 Complex III subunit 5, Rieske iron-sulfur protein, Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit RIP1 559292 integral component of membrane, mitochondrial respiratory chain complex III, mitochondrion aerobic respiration, mitochondrial electron transport, ubiquinol to cytochrome c 3036836, 8206223 8 23:30 ISQSLLAS
PSQ00813 FD00512 Collagen alpha-2(I) chain P08123 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 57 extracellular matrix structural constituent, extracellular matrix structural constituent conferring tensile strength, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding, protein-macromolecule adaptor activity, SMAD binding 1366 Alpha-2 type I collagen COL1A2 9606 collagen type I trimer, collagen-containing extracellular matrix, endoplasmic reticulum, endoplasmic reticulum lumen, extracellular exosome, extracellular matrix, extracellular region, extracellular space blood coagulation, blood vessel development, bone mineralization, cellular response to amino acid stimulus, collagen fibril organization, collagen metabolic process, cytokine-mediated signaling pathway, extracellular matrix assembly, extracellular matrix organization, leukocyte migration, odontogenesis, platelet activation, protein heterotrimerization, regulation of blood pressure, regulation of immune response, Rho protein signal transduction, skeletal system development, skin morphogenesis, transforming growth factor beta receptor signaling pathway 5529814 57 23:79 QSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAA
PSQ00814 FD00406 Lantibiotic epidermin P08136 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 30 signaling receptor binding 59 None epiA 1282 extracellular region cytolysis, defense response to bacterium 3769923 30 1:30 MEAVKEKNDLFNLDVKVNAKESNDSGAEPR
PSQ00815 FD00403 Leishmanolysin P08148 Eukaryota Discoba Euglenozoa Kinetoplastea Metakinetoplastina Trypanosomatida Trypanosomatidae Leishmaniinae Leishmania Leishmania major 61, 25 metal ion binding, metalloendopeptidase activity, metallopeptidase activity 602 Cell surface protease, Major surface glycoprotein, Major surface protease, Promastigote surface endopeptidase, Protein gp63 gp63 5664 anchored component of membrane, plasma membrane catabolism by symbiont of host protein, cell adhesion, induction by symbiont of host cytokine production, modulation by symbiont of host inflammatory response 3346625;2145267 86 40:100, 578:602 HAGALQHRCVHDAMQARVRQSVADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSV, TAAGRRGPRAAATALLVAALLAVAL
PSQ00816 FD00180 Peptidase 1 P08176 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Acari Acariformes Sarcoptiformes Astigmata Psoroptidia Analgoidea Pyroglyphidae Dermatophagoidinae Dermatophagoides Dermatophagoides pteronyssinus (European house dust mite) 80 cysteine-type peptidase activity 320 Allergen Der p I, Major mite fecal allergen Der p 1 DERP1 6956 extracellular region None 16148130, 2911558, 3372999 80 19:98 RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAE
PSQ00817 FD00321 Wound-induced proteinase inhibitor 1 P08454 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) 13 serine-type endopeptidase inhibitor activity 107 Chymotrypsin inhibitor I, Wound-induced proteinase inhibitor I None 4113 None response to wounding 4606338 13 24:36 RKESDGPEVIELQ
PSQ00818 FD00011 Aqualysin-1 P08594 Bacteria Deinococcus-Thermus Deinococci Thermales Thermaceae Thermus Thermus aquaticus 113 serine-type endopeptidase activity 513 Aqualysin-I pstI 271 extracellular region None 3162211 113 15:127 VLGGCQMASRSDPTPTLAEAFWPKEAPVYGLDDPEAIPGRYIVVFKKGKGQSLLQGGITTLQARLAPQGVVVTQAYTGALQGFAAEMAPQALEAFRQSPDVEFIEADKVVRAW
PSQ00819 FD00118 Alpha-2-antiplasmin P08697 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 12 endopeptidase inhibitor activity, protease binding, protein homodimerization activity, serine-type endopeptidase inhibitor activity 491 Alpha-2-plasmin inhibitor, Serpin F2 SERPINF2 9606 blood microparticle, cell surface, collagen-containing extracellular matrix, extracellular exosome, extracellular region, extracellular space, fibrinogen complex, platelet alpha granule lumen acute-phase response, blood vessel morphogenesis, collagen fibril organization, fibrinolysis, maintenance of blood vessel diameter homeostasis by renin-angiotensin, negative regulation of endopeptidase activity, negative regulation of fibrinolysis, negative regulation of plasminogen activation, platelet degranulation, positive regulation of cell differentiation, positive regulation of cell-cell adhesion mediated by cadherin, positive regulation of collagen biosynthetic process, positive regulation of ERK1 and ERK2 cascade, positive regulation of JNK cascade, positive regulation of smooth muscle cell proliferation, positive regulation of stress fiber assembly, positive regulation of transcription by RNA polymerase II, positive regulation of transforming growth factor beta production, response to organic substance 14751930, 16223769, 21075, 2440681 12 28:39 MEPLGRQLTSGP
PSQ00820 FD00017 Coagulation factor VII P08709 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 40 calcium ion binding, serine-type endopeptidase activity, serine-type peptidase activity, signaling receptor binding 466 Proconvertin, Serum prothrombin conversion accelerator F7 9606 collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, plasma membrane, serine-type peptidase complex, vesicle animal organ regeneration, blood coagulation, blood coagulation, extrinsic pathway, circadian rhythm, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of blood coagulation, extrinsic pathway, positive regulation of blood coagulation, positive regulation of cell migration, positive regulation of leukocyte chemotaxis, positive regulation of platelet-derived growth factor receptor signaling pathway, positive regulation of positive chemotaxis, positive regulation of protein kinase B signaling, protein processing, response to 2,3,7,8-tetrachlorodibenzodioxine, response to anticoagulant, response to astaxanthin, response to carbon dioxide, response to cholesterol, response to estradiol, response to estrogen, response to genistein, response to growth hormone, response to hypoxia, response to Thyroid stimulating hormone, response to thyrotropin-releasing hormone, response to thyroxine, response to vitamin K 3264725 40 21:60 AGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRR
PSQ00821 FD00010 Basic phospholipase A2 notechis 11 P08873 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Notechis Notechis scutatus scutatus (Mainland tiger snake) (Common tiger snake) 8 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine) 145 Phosphatidylcholine 2-acylhydrolase None 70142 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 1761049 8 20:27 SSIPARPL
PSQ00822 FD00004 Collagenase P08897 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Oestroidea Oestridae Hypodermatinae Hypoderma Hypoderma lineatum (Early cattle grub) (Common cattle grub) 14 serine-type endopeptidase activity 260 Hypodermin C None 7389 extracellular region collagen catabolic process 3034899, 6249306 14 17:30 FQHPASIFELREGR
PSQ00823 FND00065 [Phe8]-phyllolitorin P08947 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 18 None 90 None None 8395 extracellular region defense response, neuropeptide signaling pathway 3868775 18 31:48 KEVTEESDDLSKRNVLQR
PSQ00824 FND00065 [Leu8]-phyllolitorin P08948 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 18 None 90 None None 8395 extracellular region defense response, neuropeptide signaling pathway 3868775 18 31:48 KEVTEESDDLSKRNVLQR
PSQ00825 FD00121 Mucorpepsin P09177 Eukaryota Fungi Fungi incertae sedis Mucoromycota Mucoromycotina Mucoromycetes Mucorales Lichtheimiaceae Rhizomucor Rhizomucor pusillus 44 aspartic-type endopeptidase activity 427 Mucor rennin None 4840 None None 3042459 44 23:66 RPVSKQSDADDKLLALPLTSVNRKYSQTKHGQQAAEKLGGIKAF
PSQ00826 FD00517 ATP synthase subunit b P09221 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus sp 11 proton-transporting ATP synthase activity, rotational mechanism 163 ATP synthase F(0) sector subunit b , ATPase subunit I , F-type ATPase subunit b atpF 2334 integral component of membrane, plasma membrane, proton-transporting ATP synthase complex, coupling factor F(o) None 2894854 11 1:11 MLWKANVWVLG
PSQ00827 FD00011 Alkaline extracellular protease P09230 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Dipodascaceae Yarrowia Yarrowia lipolytica (strain CLIB 122 142 serine-type endopeptidase activity 454 None XPR2 284591 extracellular space None 6750031, 9353927 142 16:157 APLAAPAPAPDAAPAAVPEGPAAAAYSSILSVVAKQSKKFKHHKRDLDEKDQFIVVFDSSATVDQIASEIQKLDSLVDEDSSNGITSALDLPVYTDGSGFLGFVGKFNSTIVDKLKESSVLTVEPDTIVSLPEIPASSNAKR
PSQ00828 FD00011 Cerevisin P09232 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 261 serine-type endopeptidase activity 635 Proteinase YSCB, Vacuolar protease B PRB1 559292 extracellular space, fungal-type vacuole, fungal-type vacuole lumen cellular response to starvation, pexophagy, protein catabolic process in the vacuole, sporulation resulting in formation of a cellular spore 3325823 261 20:280 LVIPNLENAADHHELINKEDHHERPRKVEFTKDDDEEPSDSEDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSNDDDNDDKKKKPHHKGGCHENKVEEKKMKGKKVKGKKHHEKTLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEAT
PSQ00829 FD00459 Hemolysin P09545 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae serotype O1 (strain ATCC 39315 132 carbohydrate binding, identical protein binding, toxin activity 741 None hlyA 243277 extracellular region, host cell plasma membrane, integral component of membrane hemolysis in other organism, pathogenesis 2174833 132 26:157 NINEPSGEAADIISQVADSHAIKYYNAADWQAEDNALPSLAELRDLVINQQKRVLVDFSQISDAEGQAEMQAQFRKAYGVGFANQFIVITEHKGELLFTPFDQAEEVDPQLLEAPRTARLLARSGFASPAPA
PSQ00830 FD00007 Arginine esterase P09582 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Carnivora Caniformia Canidae Canis Canis lupus familiaris (Dog) (Canis familiaris) 7 serine-type endopeptidase activity 260 None None 9615 secretory granule regulation of systemic arterial blood pressure, zymogen activation 6566614 7 18:24 EPHFQPR
PSQ00831 FD00245 Phospholipase C P09598 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus cereus 14 phosphatidylcholine phospholipase C activity, zinc ion binding 283 Cereolysin A, Phosphatidylcholine cholinephosphohydrolase plc 1396 None hemolysis in other organism 1939031, 72664 14 25:38 HENDGGSKIKIVHR
PSQ00832 FD00577 Envelopment polyprotein P09613 Viruses Riboviria Orthornavirae Negarnaviricota Polyploviricotina Ellioviricetes Bunyavirales Phenuiviridae Phlebovirus Uukuniemi virus (strain S23) (Uuk) 17 None 1008 M polyprotein GP 487099 host cell endoplasmic reticulum membrane, host cell Golgi membrane, integral component of membrane, virion membrane fusion of virus membrane with host endosome membrane, viral budding from Golgi membrane, viral budding via host ESCRT complex, virion attachment to host cell 3629974 17 497:513 LSPVVVGMLCLACPVES
PSQ00833 FD00259 Guanyl-specific ribonuclease N1 P09646 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Sordariales Sordariaceae Neurospora Neurospora crassa (strain ATCC 24698 , FGSC 987) 29 endoribonuclease activity, lyase activity, RNA binding 153 None grn 367110 None None 2977130 29 21:49 AIPAPAPEAVVDVAPETATIEPTGNFTAQ
PSQ00834 FD00083 Pro-cathepsin H P09668 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 75 aminopeptidase activity, cysteine-type endopeptidase activator activity involved in apoptotic process, cysteine-type endopeptidase activity, cysteine-type peptidase activity, endopeptidase activity, HLA-A specific activating MHC class I receptor activity, peptidase activity, serine-type endopeptidase activity, thyroid hormone binding 335 None CTSH 9606 alveolar lamellar body, collagen-containing extracellular matrix, cytoplasmic ribonucleoprotein granule, cytosol, extracellular exosome, extracellular region, extracellular space, ficolin-1-rich granule lumen, intracellular membrane-bounded organelle, lysosome, multivesicular body lumen, secretory granule lumen, tertiary granule lumen adaptive immune response, antigen processing and presentation, bradykinin catabolic process, cellular protein metabolic process, cellular response to thyroid hormone stimulus, dichotomous subdivision of terminal units involved in lung branching, ERK1 and ERK2 cascade, immune response-regulating signaling pathway, membrane protein proteolysis, metanephros development, negative regulation of apoptotic process, neuropeptide catabolic process, neutrophil degranulation, positive regulation of angiogenesis, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epithelial cell migration, positive regulation of gene expression, positive regulation of peptidase activity, protein destabilization, proteolysis, proteolysis involved in cellular protein catabolic process, response to retinoic acid, surfactant homeostasis, T cell mediated cytotoxicity, zymogen activation 3342889 75 23:97 AELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWS
PSQ00835 FD00190 Fimbrial protein P09829 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Moraxellaceae Moraxella Moraxella nonliquefaciens 6 None 154 Pilin tfpA 478 integral component of membrane, pilus cell adhesion 838045 6 1:6 MNAQKG
PSQ00836 FD00579 Lactase-phlorizin hydrolase P09849 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Lagomorpha Leporidae Oryctolagus Oryctolagus cuniculus (Rabbit) 847 glycosylceramidase activity, lactase activity 1926 Lactase-glycosylceramidase LCT 9986 apical plasma membrane, integral component of membrane carbohydrate metabolic process 2460343 847 20:866 SDWESDSNFISAAGPLTTDLLLSLQYPQGNQTSDFAAGGKDLYVCSQPLPAFLPEYFSSLRASEITHYKVFLSWAQLLPAGHSGDPDGNAVRCYRQLLEALRAAQLQPMVVLHHQHLPASSALRSAVFADLFAEYATFAFHAFGDLVGVWLTFSDLEAAIRELPQPESRASRLQLLTEAHRKAYEIYHQKYAAQGGKVSVVLQAEEISELLLESSTSALAKDSIDFLSLDLSYECQSEMSLPEKLSKLQTIEPKVKVFIFTLRLQDCPSSRKSPASLLFSFIEAINKDQVLTLGFDVNAFLNCSSTSKKSISCFLTDSLALQTDHERAARNSAPVSTYQRVWEMFAHQPRAERDAFLQDTFPQGFLWGVSTGAFNVEGGWAEGGRGPSVWDQFGHLKAAQGQATPEVASDSYYKWASDVALLRGLRAQVYKFSISWSRIFPMGRGSSPSPQGVAYYNKLIDSLLDSHIEPMATLFHWDLPQALQDEGGWQNESVVDAFVDYAAFCFSAFGNRVKLWVTFHEPWVMSYAGYGTGQHAPGISDPGIASFQVAHLVLKAHARTWHHYNSHHRPQQQGRVGIVLNSDWAEPLSPERPEDLAASERFLHFMLGWFAHPIFVDGDYPATMKAQIQQRNEQCPSPVAQLPEFTDTEKQLLKGSADFLGLSHYTSRLISKAPEDSCIPSYDTIGGFSQHTDPAWPQTSSPWIRVVPWGIRRLLQFVSLEYTKGKVPIYLAGNGMPIGESENLLSDSLRVDYFNQYINEVLKAIKEDSVDVRSYIARSLMDGFEGPAGYSQRFGLYHVNFNESSKPRTPRKSAFLLTSIIEKNGFLTKAVKQPLPPNSAHLPSKTR
PSQ00837 FD00105 Somatostatin-2 P09876 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Perciformes Cottioidei Cottales Cottidae Myoxocephalus Myoxocephalus scorpius (Shorthorn sculpin) (Cottus scorpius) 46 hormone activity 74 Somatostatin II sst2 8097 extracellular region None 2883025 46 1:46 ARGAGLLSQDWSAVEDLLAQMSLPEADAQREAEVVSVATGGRLNLE
PSQ00838 FD00096 Somatoliberin P09916 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 11 growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding 104 Growth hormone-releasing factor, Growth hormone-releasing hormone Ghrh 10116 axon terminus, extracellular space, neuron projection, perikaryon, terminal bouton adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to interleukin-6, circadian sleep/wake cycle, non-REM sleep, growth hormone secretion, negative regulation of cardiac muscle cell apoptotic process, positive regulation of cAMP-mediated signaling, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, non-REM sleep, positive regulation of cytosolic calcium ion concentration, positive regulation of growth hormone secretion, positive regulation of hormone secretion, positive regulation of multicellular organism growth, positive regulation of transcription, DNA-templated, response to dexamethasone, response to food, response to hypoxia, response to leptin 6406907 11 20:30 LPPSPPFRVRR
PSQ00839 FD00226 Furin P09958 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 81 endopeptidase activity, metal ion binding, nerve growth factor binding, peptidase activity, peptide binding, protease binding, serine-type endopeptidase activity, serine-type endopeptidase inhibitor activity 794 Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme FURIN 9606 cell surface, endoplasmic reticulum, endosome membrane, extracellular exosome, extracellular region, Golgi lumen, Golgi membrane, integral component of Golgi membrane, membrane, membrane raft, plasma membrane, trans-Golgi network, trans-Golgi network transport vesicle amyloid fibril formation, blastocyst formation, collagen catabolic process, cornification, dibasic protein processing, extracellular matrix disassembly, extracellular matrix organization, negative regulation of inflammatory response to antigenic stimulus, negative regulation of low-density lipoprotein particle receptor catabolic process, negative regulation of transforming growth factor beta1 production, nerve growth factor processing, nerve growth factor production, peptide biosynthetic process, peptide hormone processing, positive regulation of membrane protein ectodomain proteolysis, positive regulation of transforming growth factor beta1 activation, protein processing, regulation of cholesterol transport, regulation of endopeptidase activity, regulation of lipoprotein lipase activity, regulation of protein catabolic process, regulation of signal transduction, secretion by cell, signal peptide processing, transforming growth factor beta receptor signaling pathway, viral life cycle, viral protein processing, zymogen activation, zymogen inhibition 9130696 81 27:107 QKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKR
PSQ00840 FD00583 Bacteriocin lactococcin-A P0A313 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Lactococcus Lactococcus lactis subsp 21 None 75 None lcnA 1359 extracellular region, host cell plasma membrane, integral component of membrane cytolysis, defense response to bacterium 1904860 21 1:21 MKNQLNFNIVSDEELSEANGG
PSQ00841 FND00307 Heat-stable enterotoxin ST P0A4M3 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae 43 toxin activity 78 Non O1-ST, Non-agglutinating cholera vibrios ST stn 666 extracellular space pathogenesis 4065341 43 19:61 QTVENNKKTVQQPQQIESKVNIKKLSENEECPFIKQVDENGNL
PSQ00842 FD00541 ATP-dependent Clp protease proteolytic subunit P0A6G7 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 14 ATP-dependent peptidase activity, ATPase binding, identical protein binding, serine-type endopeptidase activity, serine-type peptidase activity 207 Caseinolytic protease, Endopeptidase Clp , Heat shock protein F21, Protease Ti clpP 83333 cytosol, endopeptidase Clp complex, HslUV protease complex, membrane positive regulation of programmed cell death, proteasomal protein catabolic process, protein quality control for misfolded or incompletely synthesized proteins, proteolysis, response to heat, response to radiation, response to temperature stimulus 2197275 14 1:14 MSYSGERDNFAPHM
PSQ00843 FD00355 Poly(A) polymerase I P0ABF1 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 10 ATP binding, polynucleotide adenylyltransferase activity, RNA binding 465 Plasmid copy number protein pcnB 83333 cytoplasm, cytosol, plasma membrane mRNA polyadenylation, mRNA processing, plasmid maintenance, RNA modification 1438224 10 1:10 MFTRVANFCR
PSQ00844 FD00570 Peptidoglycan D P0AD68 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli (strain K12) 11 penicillin binding, peptidoglycan glycosyltransferase activity, serine-type D-Ala-D-Ala carboxypeptidase activity 588 Essential cell division protein FtsI , Murein transpeptidase , Penicillin-binding protein 3 , Peptidoglycan synthase FtsI ftsI 83333 cell division site, integral component of plasma membrane, intrinsic component of plasma membrane cell division, cell wall organization, division septum assembly, FtsZ-dependent cytokinesis, peptidoglycan biosynthetic process, regulation of cell shape, response to drug 2681146 11 578:588 INQGEGTGGRS
PSQ00845 FD00383 Streptopain P0C0J0 Bacteria Firmicutes Bacilli Lactobacillales Streptococcaceae Streptococcus Streptococcus pyogenes 118 cysteine-type peptidase activity, toxin activity 398 Exotoxin type B, SPE B, Streptococcal cysteine proteinase, Streptococcus peptidase A speB 1314 extracellular region pathogenesis, proteolysis in other organism 2198264 118 28:145 DQNFARNEKEAKDSAITFIQKSAAIKAGARSAEDIKLDKVNLGGELSGSNMYVYNISTGGFVIVSGDKRSPEILGYSTSGSFDANGKENIASFMESYVEQIKENKKLDTTYAGTAEIK
PSQ00846 FD00066 Glutamyl endopeptidase P0C0Q1 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 39 serine-type endopeptidase activity 282 Glutamic acid-specific protease gseA 1282 extracellular region pathogenesis 11767947, 12127798 39 28:66 KTDTESHNHSSLGTENKNVLDINSSSHNIKPSQNKSYPS
PSQ00847 FD00040 Extracellular elastase P0C0Q3 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 179 metal ion binding, metalloendopeptidase activity 507 SEPP1 sepA 1282 extracellular region None 8320236 179 29:207 KDKVSATQNIDAKVTQESQATDALKELPKSENIKKHYKDYKVTDTEKDNKGFTHYTLQPKVGNTYAPDKEVKVHTNKEGKVVLVNGDTDAKKVQPTNKVSISKESATDKAFEAIKIDRQKAKNLKSDVIKTNKVEIDGEKNKYVYNIEIITTSPKISHWNVKIDAETGQVVDKLNMIKE
PSQ00848 FD00559 Lipase P0C0R3 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 267 metal ion binding, triglyceride lipase activity 688 Glycerol ester hydrolase lip 1282 extracellular region lipid catabolic process 8436947 267 36:302 AEQQQDKGTVENSTTQSIGDGNEKLSEQQSTQNKNVNEKSNVNSITENESLHNETPKNEDLIQQQKDSQNDNKSESVVEQNKENGAFVQNHSEEKPQQEQVELEKHASENNQTLHSKAAQSNEDVKTKPSQLDNTAAKQEDSQKENLSKQDTQSSKTTDLLRATAQNQSKDSQSTEEINKEVNNDTQQVTAKNDDAKVESFNLNSKEEPLKVDKQANPTTDKDKSSKNDKGSQDGLANLESNAVATTNKQSKQQVSEKNEDQTNKSA
PSQ00849 FD00003 Conotoxin mr3d P0C1N1 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus Conus marmoreus (Marble cone) 33 ion channel inhibitor activity, toxin activity 67 Conotoxin Mr3 None 42752 extracellular region pathogenesis 17042781 33 20:52 VPLDGDQPADRPAERMQDDISSEHHPFFDPVKR
PSQ00850 FD00003 Conotoxin mr3g P0C1N5 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus Conus marmoreus (Marble cone) 32 ion channel inhibitor activity, toxin activity 68 Mr3 None 42752 extracellular region pathogenesis 17042781 32 20:51 VPLDGDQPADRPAERMQDDISSERHPMFDAVR
Total Pages 43
Go to Lab Web Page