Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00757

ProSeqID PSQ00757
Family FD00418
Protein Name Cytochrome b5 type B
UniProt ID P04166
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 11
Functions electron transfer activity, enzyme activator activity, heme binding, metal ion binding, nitrite reductase (NO-forming) activity, ubiquinol-cytochrome-c reductase activity
Preproprotein Length (aa) 146
Alt Name Cytochrome b5 outer mitochondrial membrane isoform
Gene Name Cyb5b
NCBI ID 10116
Cellular Localization integral component of membrane, intracellular membrane-bounded organelle, membrane, mitochondrial outer membrane, nitric-oxide synthase complex
Processes nitric oxide biosynthetic process
PubMed 6840088
Total Prosequence Length (aa) 11
Prosequence Location 1:11
Prosequence Sequence MATPEASGSGR
Preproprotein Sequence MATPEASGSGRNGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAILIGFLYRHFWADSKSS