| ProSeqID | PSQ00752 |
| Family | FD00169 |
| Protein Name | Inhibin beta A chain |
| UniProt ID | P03970 |
| Taxonomy | Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Suina-Suidae-Sus |
| Organisms | Sus scrofa (Pig) |
| Prosequence Length (aa) | 288 |
| Functions | cytokine activity, growth factor activity, hormone activity, identical protein binding, peptide hormone binding, type II activin receptor binding |
| Preproprotein Length (aa) | 424 |
| Alt Name | Activin beta-A chain |
| Gene Name | INHBA |
| NCBI ID | 9823 |
| Cellular Localization | activin A complex, extracellular region, extracellular space, inhibin A complex, perinuclear region of cytoplasm |
| Processes | activin receptor signaling pathway, cell cycle arrest, endodermal cell differentiation, extrinsic apoptotic signaling pathway, eyelid development in camera-type eye, G1/S transition of mitotic cell cycle, GABAergic neuron differentiation, hair follicle development, hematopoietic progenitor cell differentiation, hemoglobin biosynthetic process, male gonad development, mesodermal cell differentiation, negative regulation of cell cycle, negative regulation of cell growth, negative regulation of cell population proliferation, negative regulation of hair follicle development, odontogenesis, ovarian follicle development, positive regulation of erythrocyte differentiation, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of ovulation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, progesterone secretion, regulation of follicle-stimulating hormone secretion, regulation of transcription by RNA polymerase II, response to drug, roof of mouth development, SMAD protein signal transduction, striatal medium spiny neuron differentiation |
| PubMed | 1644823 |
| Total Prosequence Length (aa) | 288 |
| Prosequence Location | 21:308 |
| Prosequence Sequence | SPTPGSGGHSAAPDCPSCALATLPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVELEDDIGRRAEMNELMEQTSEIITFAEAGTARKTLRFEISKEGSDLSVVERAEIWLFLKVPKANRTRTKVSIRLFQQQRRPQGSADAGEEAEDVGFPEEKSEVLISEKVVDARKSTWHIFPVSSSIQRLLDQGKSALDIRTACEQCHETGASLVLLGKKKKKEEEAEGRKRDGEGAGVDEEKEQSHRPFLMLQARQSEEHPHRRRRR |
| Preproprotein Sequence | MPLLWLRGFLLASCWIIVRSSPTPGSGGHSAAPDCPSCALATLPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVELEDDIGRRAEMNELMEQTSEIITFAEAGTARKTLRFEISKEGSDLSVVERAEIWLFLKVPKANRTRTKVSIRLFQQQRRPQGSADAGEEAEDVGFPEEKSEVLISEKVVDARKSTWHIFPVSSSIQRLLDQGKSALDIRTACEQCHETGASLVLLGKKKKKEEEAEGRKRDGEGAGVDEEKEQSHRPFLMLQARQSEEHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS |