Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00751

ProSeqID PSQ00751
Family FD00239
Protein Name Fibroblast growth factor 2
UniProt ID P03969
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Ruminantia-Pecora-Bovidae-Bovinae-Bos
Organisms Bos taurus (Bovine)
Prosequence Length (aa) 9
Functions fibroblast growth factor receptor binding, growth factor activity, heparin binding, integrin binding
Preproprotein Length (aa) 155
Alt Name Basic fibroblast growth factor, Heparin-binding growth factor 2
Gene Name FGF2
NCBI ID 9913
Cellular Localization cytoplasm, extracellular space, nucleus
Processes activation of MAPKK activity, angiogenesis, animal organ morphogenesis, branching involved in ureteric bud morphogenesis, cell differentiation, corticotropin hormone secreting cell differentiation, fibroblast growth factor receptor signaling pathway, glial cell differentiation, lung development, mammary gland epithelial cell differentiation, negative regulation of cell death, negative regulation of cell population proliferation, organ induction, positive regulation of angiogenesis, positive regulation of blood vessel endothelial cell migration, positive regulation of canonical Wnt signaling pathway, positive regulation of cell division, positive regulation of cell migration involved in sprouting angiogenesis, positive regulation of cell population proliferation, positive regulation of cerebellar granule cell precursor proliferation, positive regulation of endothelial cell migration, positive regulation of endothelial cell proliferation, positive regulation of epithelial cell proliferation, positive regulation of ERK1 and ERK2 cascade, positive regulation of gene expression, positive regulation of lens fiber cell differentiation, positive regulation of MAP kinase activity, positive regulation of osteoblast differentiation, positive regulation of protein kinase B signaling, positive regulation of protein phosphorylation, positive regulation of sprouting angiogenesis, positive regulation of transcription by RNA polymerase II, regulation of cell cycle, regulation of cell migration, regulation of retinal cell programmed cell death, response to axon injury, signal transduction, stem cell development, substantia nigra development, thyroid-stimulating hormone-secreting cell differentiation, wound healing
PubMed 3741423, 3863109, 3940857
Total Prosequence Length (aa) 9
Prosequence Location 1:9
Prosequence Sequence MAAGSITTL
Preproprotein Sequence MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS