Details of PSQ01326
| ProSeqID |
PSQ01326 |
| Family |
FD00129 |
| Protein Name |
Vascular endothelial growth factor C |
| UniProt ID |
P49767
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
80 |
| Functions |
chemoattractant activity, growth factor activity, vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor binding |
| Preproprotein Length (aa) |
420 |
| Alt Name |
Flt4 ligand, Vascular endothelial growth factor-related protein |
| Gene Name |
VEGFC |
| NCBI ID |
9606 |
| Cellular Localization |
extracellular region, extracellular space, membrane, platelet alpha granule lumen |
| Processes |
animal organ morphogenesis, cellular response to leukemia inhibitory factor, induction of positive chemotaxis, morphogenesis of embryonic epithelium, negative regulation of blood pressure, negative regulation of osteoblast differentiation, platelet degranulation, positive regulation of angiogenesis, positive regulation of blood vessel endothelial cell migration, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of endothelial cell proliferation, positive regulation of lymphangiogenesis, positive regulation of mast cell chemotaxis, positive regulation of mesenchymal stem cell proliferation, positive regulation of neuroblast proliferation, positive regulation of protein autophosphorylation, positive regulation of protein kinase activity, positive regulation of protein phosphorylation, positive regulation of protein secretion, regulation of vascular endothelial growth factor receptor signaling pathway, response to drug, response to hypoxia, signal transduction, sprouting angiogenesis, substrate-dependent cell migration, vascular endothelial growth factor receptor signaling pathway, vascular endothelial growth factor signaling pathway |
| PubMed |
9233800
|
| Total Prosequence Length (aa) |
80 |
| Prosequence Location |
32:111 |
| Prosequence Sequence |
FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAA |
| Preproprotein Sequence |
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS |
