Details of PSQ01329
| ProSeqID |
PSQ01329 |
| Family |
FD00587 |
| Protein Name |
Matrix metalloproteinase-14 |
| UniProt ID |
P50281
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
91 |
| Functions |
endopeptidase activity, integrin binding, metalloaminopeptidase activity, metalloendopeptidase activity, zinc ion binding |
| Preproprotein Length (aa) |
582 |
| Alt Name |
MMP-X1, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase |
| Gene Name |
MMP14 |
| NCBI ID |
9606 |
| Cellular Localization |
cytoplasmic vesicle, cytosol, extracellular matrix, extracellular space, focal adhesion, Golgi lumen, integral component of plasma membrane, intermediate filament cytoskeleton, macropinosome, melanosome, nucleus, plasma membrane |
| Processes |
angiogenesis, astrocyte cell migration, branching morphogenesis of an epithelial tube, cell motility, chondrocyte proliferation, collagen catabolic process, craniofacial suture morphogenesis, embryonic cranial skeleton morphogenesis, endochondral ossification, endodermal cell differentiation, endothelial cell proliferation, extracellular matrix disassembly, extracellular matrix organization, head development, lung development, male gonad development, negative regulation of focal adhesion assembly, negative regulation of Notch signaling pathway, ovarian follicle development, positive regulation of B cell differentiation, positive regulation of cell growth, positive regulation of cell migration, positive regulation of macrophage migration, positive regulation of myotube differentiation, positive regulation of protein processing, protein processing, proteolysis, regulation of protein localization to plasma membrane, response to estrogen, response to hypoxia, response to mechanical stimulus, response to odorant, response to organic cyclic compound, response to oxidative stress, skeletal system development, tissue remodeling, zymogen activation |
| PubMed |
8804434
|
| Total Prosequence Length (aa) |
91 |
| Prosequence Location |
21:111 |
| Prosequence Sequence |
ALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKR |
| Preproprotein Sequence |
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV |
