Details of PSQ01179
| ProSeqID |
PSQ01179 |
| Family |
FD00101 |
| Protein Name |
Proteasome subunit beta type-5 |
| UniProt ID |
P28074
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
59 |
| Functions |
endopeptidase activity, peptidase activity, threonine-type endopeptidase activity |
| Preproprotein Length (aa) |
263 |
| Alt Name |
Macropain epsilon chain, Multicatalytic endopeptidase complex epsilon chain, Proteasome chain 6, Proteasome epsilon chain, Proteasome subunit MB1, Proteasome subunit X |
| Gene Name |
PSMB5 |
| NCBI ID |
9606 |
| Cellular Localization |
centrosome, cytoplasm, cytosol, extracellular exosome, nucleoplasm, nucleus, proteasome complex, proteasome core complex, proteasome core complex, beta-subunit complex |
| Processes |
anaphase-promoting complex-dependent catabolic process, antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent, Fc-epsilon receptor signaling pathway, interleukin-1-mediated signaling pathway, MAPK cascade, negative regulation of canonical Wnt signaling pathway, negative regulation of G2/M transition of mitotic cell cycle, NIK/NF-kappaB signaling, positive regulation of canonical Wnt signaling pathway, post-translational protein modification, pre-replicative complex assembly, proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, protein deubiquitination, protein polyubiquitination, proteolysis, regulation of cellular amino acid metabolic process, regulation of hematopoietic stem cell differentiation, regulation of mitotic cell cycle phase transition, regulation of mRNA stability, regulation of transcription from RNA polymerase II promoter in response to hypoxia, response to oxidative stress, SCF-dependent proteasomal ubiquitin-dependent protein catabolic process, stimulatory C-type lectin receptor signaling pathway, T cell receptor signaling pathway, transmembrane transport, tumor necrosis factor-mediated signaling pathway, viral process, Wnt signaling pathway, planar cell polarity pathway |
| PubMed |
2306472
|
| Total Prosequence Length (aa) |
59 |
| Prosequence Location |
1:59 |
| Prosequence Sequence |
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHG |
| Preproprotein Sequence |
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP |
