Details of PSQ01327
| ProSeqID |
PSQ01327 |
| Family |
FD00550 |
| Protein Name |
Cathelicidin antimicrobial peptide |
| UniProt ID |
P49913
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
101 |
| Functions |
lipopolysaccharide binding |
| Preproprotein Length (aa) |
170 |
| Alt Name |
18 kDa cationic antimicrobial protein |
| Gene Name |
CAMP |
| NCBI ID |
9606 |
| Cellular Localization |
extracellular exosome, extracellular region, extracellular space, specific granule, specific granule lumen, tertiary granule lumen |
| Processes |
antibacterial humoral response, antifungal humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, chronic inflammatory response, cytolysis by host of symbiont cells, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response, innate immune response in mucosa, killing by host of symbiont cells, modulation of process of other organism, neutrophil degranulation, positive regulation of interleukin-8 production, response to yeast |
| PubMed |
7615076
|
| Total Prosequence Length (aa) |
101 |
| Prosequence Location |
31:131 |
| Prosequence Sequence |
QVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKR |
| Preproprotein Sequence |
MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
