Details of PSQ01426
| ProSeqID |
PSQ01426 |
| Family |
FD00416 |
| Protein Name |
Disintegrin and metalloproteinase domain-containing protein 17 |
| UniProt ID |
P78536
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
197 |
| Functions |
endopeptidase activity, integrin binding, interleukin-6 receptor binding, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, Notch binding, PDZ domain binding, peptidase activity, SH3 domain binding |
| Preproprotein Length (aa) |
824 |
| Alt Name |
Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme |
| Gene Name |
ADAM17 |
| NCBI ID |
9606 |
| Cellular Localization |
actin cytoskeleton, apical plasma membrane, cell surface, cytoplasm, cytosol, endoplasmic reticulum lumen, Golgi membrane, integral component of plasma membrane, membrane, membrane raft, plasma membrane |
| Processes |
amyloid precursor protein catabolic process, B cell differentiation, cell adhesion, cell adhesion mediated by integrin, cell motility, cellular response to high density lipoprotein particle stimulus, defense response to Gram-positive bacterium, epidermal growth factor receptor signaling pathway, germinal center formation, membrane protein ectodomain proteolysis, membrane protein intracellular domain proteolysis, negative regulation of cold-induced thermogenesis, negative regulation of inflammatory response to antigenic stimulus, negative regulation of transforming growth factor beta receptor signaling pathway, neutrophil mediated immunity, Notch receptor processing, Notch signaling pathway, positive regulation of blood vessel endothelial cell migration, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of cellular component movement, positive regulation of chemokine production, positive regulation of cyclin-dependent protein serine/threonine kinase activity, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of G1/S transition of mitotic cell cycle, positive regulation of leukocyte chemotaxis, positive regulation of protein phosphorylation, positive regulation of T cell chemotaxis, positive regulation of transforming growth factor beta receptor signaling pathway, positive regulation of tumor necrosis factor-mediated signaling pathway, positive regulation of vascular endothelial cell proliferation, protein processing, proteolysis, receptor transactivation, regulation of mast cell apoptotic process, response to drug, response to hypoxia, response to lipopolysaccharide, spleen development, T cell differentiation in thymus, tumor necrosis factor-mediated signaling pathway, wound healing, spreading of epidermal cells |
| PubMed |
9034191
|
| Total Prosequence Length (aa) |
197 |
| Prosequence Location |
18:214 |
| Prosequence Sequence |
PRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKR |
| Preproprotein Sequence |
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC |
