Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01469

ProSeqID PSQ01469
Family FD00444
Protein Name Dermcidin
UniProt ID P81605
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 13
Functions peptidase activity, RNA binding
Preproprotein Length (aa) 110
Alt Name Preproteolysin
Gene Name DCD
NCBI ID 9606
Cellular Localization extracellular exosome, extracellular region, extracellular space
Processes antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, defense response to bacterium, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing by host of symbiont cells, killing of cells of other organism
PubMed 11694882
Total Prosequence Length (aa) 13
Prosequence Location 50:62
Prosequence Sequence GLARQAPKPRKQR
Preproprotein Sequence MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL