Details of PSQ01339
| ProSeqID |
PSQ01339 |
| Family |
FD00499 |
| Protein Name |
Dipeptidyl peptidase 1 |
| UniProt ID |
P53634
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
96 |
| Functions |
chaperone binding, chloride ion binding, cysteine-type endopeptidase activity, cysteine-type peptidase activity, dipeptidyl-peptidase activity, identical protein binding, peptidase activator activity involved in apoptotic process, phosphatase binding, protein self-association, serine-type endopeptidase activity |
| Preproprotein Length (aa) |
463 |
| Alt Name |
Cathepsin C, Cathepsin J, Dipeptidyl peptidase I, Dipeptidyl transferase |
| Gene Name |
CTSC |
| NCBI ID |
9606 |
| Cellular Localization |
azurophil granule lumen, centrosome, collagen-containing extracellular matrix, COPII-coated ER to Golgi transport vesicle, endoplasmic reticulum lumen, endoplasmic reticulum-Golgi intermediate compartment membrane, extracellular exosome, extracellular region, extracellular space, Golgi apparatus, intracellular membrane-bounded organelle, lysosome, membrane, nucleoplasm |
| Processes |
aging, COPII vesicle coating, endoplasmic reticulum to Golgi vesicle-mediated transport, immune response, negative regulation of myelination, neutrophil degranulation, positive regulation of apoptotic signaling pathway, positive regulation of microglial cell activation, positive regulation of proteolysis involved in cellular protein catabolic process, proteolysis, proteolysis involved in cellular protein catabolic process, response to organic substance, T cell mediated cytotoxicity |
| PubMed |
1586157,
7665576,
9507095
|
| Total Prosequence Length (aa) |
96 |
| Prosequence Location |
135:230 |
| Prosequence Sequence |
ACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILH |
| Preproprotein Sequence |
MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL |