Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01390

ProSeqID PSQ01390
Family FD00484
Protein Name Beta-defensin 1
UniProt ID P60022
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 11
Functions CCR6 chemokine receptor binding, identical protein binding
Preproprotein Length (aa) 68
Alt Name Defensin
Gene Name DEFB1
NCBI ID 9606
Cellular Localization extracellular exosome, extracellular region, extracellular space, extrinsic component of membrane, Golgi lumen, microvesicle, sperm midpiece
Processes antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, calcium-mediated signaling using intracellular calcium source, cAMP-mediated signaling, chemotaxis, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, G protein-coupled receptor signaling pathway, immune response, innate immune response, innate immune response in mucosa, positive regulation of flagellated sperm motility involved in capacitation, response to bacterium
PubMed 7628632
Total Prosequence Length (aa) 11
Prosequence Location 22:32
Prosequence Sequence GNFLTGLGHRS
Preproprotein Sequence MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK