Details of PSQ00713
| ProSeqID |
PSQ00713 |
| Family |
FD00096 |
| Protein Name |
Somatoliberin |
| UniProt ID |
P01286
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
11 |
| Functions |
growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding |
| Preproprotein Length (aa) |
108 |
| Alt Name |
Growth hormone-releasing factor, Growth hormone-releasing hormone, Somatocrinin, Somatorelin |
| Gene Name |
GHRH |
| NCBI ID |
9606 |
| Cellular Localization |
extracellular region, extracellular space, perikaryon, terminal bouton |
| Processes |
adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, G protein-coupled receptor signaling pathway, growth hormone secretion, negative regulation of inflammatory response to antigenic stimulus, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, REM sleep, positive regulation of growth hormone secretion, positive regulation of insulin-like growth factor receptor signaling pathway, positive regulation of multicellular organism growth, response to food |
| PubMed |
6812220
|
| Total Prosequence Length (aa) |
11 |
| Prosequence Location |
21:31 |
| Prosequence Sequence |
PPPPLTLRMRR |
| Preproprotein Sequence |
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG |
