Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00651

ProSeqID PSQ00651
Family FD00298
Protein Name Interleukin-33
UniProt ID O95760
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 94
Functions cytokine activity, interleukin-33 receptor binding
Preproprotein Length (aa) 270
Alt Name Interleukin-1 family member 11, Nuclear factor from high endothelial venules
Gene Name IL33
NCBI ID 9606
Cellular Localization chromosome, cytoplasm, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm, nucleus, transport vesicle
Processes defense response to virus, extrinsic apoptotic signaling pathway, interleukin-33-mediated signaling pathway, microglial cell activation involved in immune response, microglial cell proliferation, negative regulation of immunoglobulin production, negative regulation of interferon-gamma production, negative regulation of leukocyte migration, negative regulation of macrophage proliferation, negative regulation of T-helper 1 type immune response, negative regulation of transcription by RNA polymerase II, positive regulation of CD80 production, positive regulation of CD86 production, positive regulation of cellular defense response, positive regulation of chemokine production, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immunoglobulin production, positive regulation of inflammatory response, positive regulation of interleukin-13 production, positive regulation of interleukin-4 production, positive regulation of interleukin-5 production, positive regulation of interleukin-6 production, positive regulation of macrophage activation, positive regulation of MHC class I biosynthetic process, positive regulation of MHC class II biosynthetic process, positive regulation of neuroinflammatory response, positive regulation of nitric-oxide synthase biosynthetic process, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of type 2 immune response, protein deubiquitination
PubMed 22307629
Total Prosequence Length (aa) 94
Prosequence Location 1:94
Prosequence Sequence MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECF
Preproprotein Sequence MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET