Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00711

ProSeqID PSQ00711
Family FD00165
Protein Name Parathyroid hormone
UniProt ID P01270
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 6
Functions hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, receptor ligand activity, type 1 parathyroid hormone receptor binding
Preproprotein Length (aa) 120
Alt Name Parathormone, Parathyrin
Gene Name PTH
NCBI ID 9606
Cellular Localization extracellular region, extracellular space
Processes activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, bone resorption, cAMP metabolic process, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, G protein-coupled receptor signaling pathway, homeostasis of number of cells within a tissue, hormone-mediated apoptotic signaling pathway, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of bone mineralization involved in bone maturation, negative regulation of chondrocyte differentiation, negative regulation of gene expression, negative regulation of inflammatory response to antigenic stimulus, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II, regulation of gene expression, response to cadmium ion, response to drug, response to ethanol, response to fibroblast growth factor, response to lead ion, response to parathyroid hormone, response to vitamin D, Rho protein signal transduction, skeletal system development
PubMed 4521809
Total Prosequence Length (aa) 6
Prosequence Location 26:31
Prosequence Sequence KSVKKR
Preproprotein Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ