Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00722

ProSeqID PSQ00722
Family FD00092
Protein Name Interleukin-1 alpha
UniProt ID P01583
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 112
Functions copper ion binding, cytokine activity, interleukin-1 receptor binding
Preproprotein Length (aa) 271
Alt Name Hematopoietin-1
Gene Name IL1A
NCBI ID 9606
Cellular Localization cytosol, extracellular region, extracellular space
Processes apoptotic process, cellular response to heat, cellular response to lipopolysaccharide, cellular sodium ion homeostasis, connective tissue replacement involved in inflammatory response wound healing, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, immune response, inflammatory response, interleukin-1-mediated signaling pathway, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of vascular endothelial growth factor production, regulation of nitric-oxide synthase activity, response to copper ion
PubMed 3281727
Total Prosequence Length (aa) 112
Prosequence Location 1:112
Prosequence Sequence MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPR
Preproprotein Sequence MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA