Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00723

ProSeqID PSQ00723
Family FD00092
Protein Name Interleukin-1 beta
UniProt ID P01584
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 116
Functions cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding
Preproprotein Length (aa) 269
Alt Name Catabolin
Gene Name IL1B
NCBI ID 9606
Cellular Localization cytosol, extracellular region, extracellular space, lysosome
Processes activation of MAPK activity, apoptotic process, cell-cell signaling, cellular response to drug, cellular response to lipopolysaccharide, cellular response to mechanical stimulus, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, embryo implantation, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, lipopolysaccharide-mediated signaling pathway, MAPK cascade, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of glucose transmembrane transport, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neurogenesis, negative regulation of synaptic transmission, positive regulation of angiogenesis, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell adhesion molecule production, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of complement activation, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of histone acetylation, positive regulation of histone phosphorylation, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuroinflammatory response, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein export from nucleus, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of T cell mediated immunity, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, positive regulation of vascular endothelial growth factor receptor signaling pathway, protein kinase B signaling, purinergic nucleotide receptor signaling pathway, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, signal transduction, smooth muscle adaptation, vascular endothelial growth factor production
PubMed 3281727, 3920526
Total Prosequence Length (aa) 116
Prosequence Location 1:116
Prosequence Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHD
Preproprotein Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS