Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00712

ProSeqID PSQ00712
Family FD00432
Protein Name Pro-glucagon
UniProt ID P01275
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 6
Functions glucagon receptor binding, hormone activity, identical protein binding, signaling receptor binding
Preproprotein Length (aa) 180
Alt Name None
Gene Name GCG
NCBI ID 9606
Cellular Localization endoplasmic reticulum lumen, extracellular region, extracellular space, secretory granule lumen
Processes adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to glucagon stimulus, feeding behavior, G protein-coupled receptor signaling pathway, glucose homeostasis, negative regulation of apoptotic process, negative regulation of execution phase of apoptosis, negative regulation of inflammatory response to antigenic stimulus, positive regulation of calcium ion import, positive regulation of ERK1 and ERK2 cascade, positive regulation of gluconeogenesis, positive regulation of histone H3-K4 methylation, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of protein binding, positive regulation of protein kinase activity, protein kinase A signaling, regulation of insulin secretion, response to activity
PubMed 2753890
Total Prosequence Length (aa) 6
Prosequence Location 84:89
Prosequence Sequence NRNNIA
Preproprotein Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK