Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
PreProtein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions PreProtein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ00595 FD00425 Agouti-related protein O00253 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 62 melanocortin receptor binding, neuropeptide hormone activity, signaling receptor binding, type 1 melanocortin receptor binding 132 None AGRP 9606 extracellular space, Golgi lumen, neuronal cell body adult feeding behavior, circadian rhythm, eating behavior, feeding behavior, hormone-mediated signaling pathway, long-day photoperiodism, maternal process involved in female pregnancy, neuropeptide signaling pathway, positive regulation of feeding behavior, regulation of feeding behavior, response to insulin 16384863, 17185225 62 21:82 AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR
PSQ00603 FD00087 Tripeptidyl-peptidase 1 O14773 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 176 endopeptidase activity, lysophosphatidic acid binding, metal ion binding, peptidase activity, peptide binding, serine-type endopeptidase activity, serine-type peptidase activity, sulfatide binding, tripeptidyl-peptidase activity 563 Cell growth-inhibiting gene 1 protein, Lysosomal pepstatin-insensitive protease, Tripeptidyl aminopeptidase, Tripeptidyl-peptidase I TPP1 9606 extracellular exosome, Golgi apparatus, lysosomal lumen, lysosome, melanosome, membrane raft, recycling endosome bone resorption, central nervous system development, epithelial cell differentiation, IRE1-mediated unfolded protein response, lipid metabolic process, lysosomal protein catabolic process, lysosome organization, nervous system development, neuromuscular process controlling balance, peptide catabolic process, protein catabolic process, protein localization to chromosome, telomeric region, proteolysis 11054422, 25944712 176 20:195 SYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVG
PSQ00614 FD00189 Serine protease HTRA2 O43464 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 102 identical protein binding, peptidase activity, serine-type endopeptidase activity, serine-type peptidase activity, unfolded protein binding 458 High temperature requirement protein A2, Omi stress-regulated endoprotease, Serine protease 25, Serine proteinase OMI HTRA2 9606 CD40 receptor complex, chromatin, cytoplasmic side of plasma membrane, cytoskeleton, cytosol, endoplasmic reticulum, endoplasmic reticulum membrane, membrane, mitochondrial intermembrane space, mitochondrial membrane, mitochondrion, nucleus, serine-type endopeptidase complex adult walking behavior, aging, cellular protein catabolic process, cellular response to growth factor stimulus, cellular response to heat, cellular response to interferon-beta, cellular response to oxidative stress, cellular response to retinoic acid, ceramide metabolic process, execution phase of apoptosis, forebrain development, intrinsic apoptotic signaling pathway in response to DNA damage, mitochondrion organization, negative regulation of cell cycle, negative regulation of mitophagy in response to mitochondrial depolarization, negative regulation of neuron death, negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway, neuron development, pentacyclic triterpenoid metabolic process, positive regulation of apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic process, positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of mitochondrion organization, positive regulation of protein targeting to mitochondrion, programmed cell death, protein autoprocessing, proteolysis, regulation of autophagy of mitochondrion, regulation of multicellular organism growth, response to herbicide 11583623 102 32:133 TPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLA
PSQ00615 FD00244 Peptidase inhibitor 15 O43692 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 41 peptidase inhibitor activity 258 25 kDa trypsin inhibitor, Cysteine-rich secretory protein 8, SugarCrisp PI15 9606 extracellular exosome, extracellular space multicellular organism development 8882727 41 20:60 STVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR
PSQ00616 FD00129 Vascular endothelial growth factor D O43915 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 67 chemoattractant activity, growth factor activity, identical protein binding, platelet-derived growth factor receptor binding, vascular endothelial growth factor receptor 3 binding, vascular endothelial growth factor receptor binding 360 c-Fos-induced growth factor VEGFD 9606 extracellular region, extracellular space, membrane, platelet alpha granule lumen cell population proliferation, dopaminergic neuron differentiation, induction of positive chemotaxis, platelet degranulation, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of endothelial cell proliferation, positive regulation of mast cell chemotaxis, positive regulation of protein phosphorylation, response to bacterium, response to hypoxia, sprouting angiogenesis, vascular endothelial growth factor receptor signaling pathway, vascular endothelial growth factor signaling pathway 10542248 67 22:88 SSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLRLKSFTSMDSRSASHRSTR
PSQ00624 FD00396 Cubilin O60494 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 12 calcium ion binding, cargo receptor activity, cobalamin binding, protein homodimerization activity, signaling receptor activity 3623 460 kDa receptor, Intestinal intrinsic factor receptor, Intrinsic factor-cobalamin receptor, Intrinsic factor-vitamin B12 receptor CUBN 9606 apical plasma membrane, brush border membrane, clathrin-coated pit, cytosol, endocytic vesicle, endoplasmic reticulum, endosome membrane, extracellular exosome, extrinsic component of external side of plasma membrane, Golgi apparatus, lysosomal lumen, lysosomal membrane, membrane, plasma membrane, receptor complex cholesterol metabolic process, cobalamin metabolic process, cobalamin transport, high-density lipoprotein particle clearance, lipoprotein transport, receptor-mediated endocytosis, response to bacterium, tissue homeostasis, vitamin D metabolic process 9572993 12 24:35 EAGELELQRQKR
PSQ00631 FD00531 Attractin O75882 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 55 carbohydrate binding, signaling receptor activity 1429 DPPT-L, Mahogany homolog ATRN 9606 basement membrane, cytoplasm, extracellular exosome, extracellular space, integral component of plasma membrane, plasma membrane animal organ morphogenesis, cell migration, cerebellum development, inflammatory response, myelination, pigmentation, regulation of multicellular organism growth, response to oxidative stress, substrate adhesion-dependent cell spreading, tissue development 17261078 55 29:83 PHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPRLLLLLLLLSPPLLLLLLPCEAEA
PSQ00651 FD00298 Interleukin-33 O95760 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 94 cytokine activity, interleukin-33 receptor binding 270 Interleukin-1 family member 11, Nuclear factor from high endothelial venules IL33 9606 chromosome, cytoplasm, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm, nucleus, transport vesicle defense response to virus, extrinsic apoptotic signaling pathway, interleukin-33-mediated signaling pathway, microglial cell activation involved in immune response, microglial cell proliferation, negative regulation of immunoglobulin production, negative regulation of interferon-gamma production, negative regulation of leukocyte migration, negative regulation of macrophage proliferation, negative regulation of T-helper 1 type immune response, negative regulation of transcription by RNA polymerase II, positive regulation of CD80 production, positive regulation of CD86 production, positive regulation of cellular defense response, positive regulation of chemokine production, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immunoglobulin production, positive regulation of inflammatory response, positive regulation of interleukin-13 production, positive regulation of interleukin-4 production, positive regulation of interleukin-5 production, positive regulation of interleukin-6 production, positive regulation of macrophage activation, positive regulation of MHC class I biosynthetic process, positive regulation of MHC class II biosynthetic process, positive regulation of neuroinflammatory response, positive regulation of nitric-oxide synthase biosynthetic process, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of type 2 immune response, protein deubiquitination 22307629 94 1:94 MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECF
PSQ00652 FD00534 Apoptosis-inducing factor 1 O95831 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 47 DNA binding, FAD binding, NAD(P)H oxidase H2O2-forming activity, NADH dehydrogenase activity, oxidoreductase activity, acting on NAD(P)H, protein dimerization activity 613 Programmed cell death protein 8 AIFM1 9606 cytosol, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrion, nucleus, perinuclear region of cytoplasm activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, chromosome condensation, intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress, mitochondrial respiratory chain complex assembly, mitochondrial respiratory chain complex I assembly, neuron differentiation, positive regulation of apoptotic process, protein import into mitochondrial intermembrane space 16365034 47 55:101 ASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISG
PSQ00675 FD00348 Prothrombin P00734 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 calcium ion binding, enzyme activator activity, growth factor activity, heparin binding, lipopolysaccharide binding, serine-type endopeptidase activity, signaling receptor binding, thrombospondin receptor activity 622 Coagulation factor II F2 9606 blood microparticle, collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, Golgi lumen, plasma membrane acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, blood coagulation, blood coagulation, intrinsic pathway, cell surface receptor signaling pathway, cellular protein metabolic process, cytolysis by host of symbiont cells, endoplasmic reticulum to Golgi vesicle-mediated transport, fibrinolysis, G protein-coupled receptor signaling pathway, leukocyte migration, multicellular organism development, negative regulation of astrocyte differentiation, negative regulation of cytokine production involved in inflammatory response, negative regulation of fibrinolysis, negative regulation of platelet activation, negative regulation of proteolysis, neutrophil-mediated killing of gram-negative bacterium, platelet activation, positive regulation of blood coagulation, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of collagen biosynthetic process, positive regulation of lipid kinase activity, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway, positive regulation of protein localization to nucleus, positive regulation of protein phosphorylation, positive regulation of reactive oxygen species metabolic process, positive regulation of receptor signaling pathway via JAK-STAT, positive regulation of release of sequestered calcium ion into cytosol, proteolysis, regulation of blood coagulation, regulation of cell shape, regulation of complement activation, regulation of cytosolic calcium ion concentration, response to wounding 266717, 8073540 19 25:43 QHVFLAPQQARSLLQRVRR
PSQ00676 FD00017 Coagulation factor IX P00740 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 18 calcium ion binding, endopeptidase activity, serine-type endopeptidase activity 461 Christmas factor, Plasma thromboplastin component F9 9606 collagen-containing extracellular matrix, endoplasmic reticulum lumen, extracellular exosome, extracellular region, extracellular space, Golgi lumen, plasma membrane blood coagulation, blood coagulation, intrinsic pathway, endoplasmic reticulum to Golgi vesicle-mediated transport, proteolysis, zymogen activation 2592373 18 29:46 TVFLDHENANKILNRPKR
PSQ00677 FD00017 Coagulation factor X P00742 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 9 calcium ion binding, phospholipid binding, serine-type endopeptidase activity 488 Stuart factor, Stuart-Prower factor F10 9606 endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, intrinsic component of external side of plasma membrane, plasma membrane blood coagulation, blood coagulation, extrinsic pathway, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of blood coagulation, extrinsic pathway, positive regulation of cell migration, positive regulation of protein kinase B signaling 6871167 9 32:40 NNILARVTR
PSQ00680 FD00300 Tissue-type plasminogen activator P00750 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 10 phosphoprotein binding, serine-type endopeptidase activity, signaling receptor binding 562 None PLAT 9606 cell surface, cytoplasm, extracellular exosome, extracellular region, extracellular space blood coagulation, cellular protein modification process, fibrinolysis, negative regulation of proteolysis, plasminogen activation, platelet-derived growth factor receptor signaling pathway, prevention of polyspermy, proteolysis, smooth muscle cell migration 6682760 10 23:32 SQEIHARFRR
PSQ00697 FD00099 Renin P00797 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 43 aspartic-type endopeptidase activity, insulin-like growth factor receptor binding, peptidase activity, signaling receptor binding 406 Angiotensinogenase REN 9606 apical part of cell, cytoplasm, extracellular region, extracellular space, plasma membrane amyloid-beta metabolic process, angiotensin maturation, cell maturation, cellular response to drug, drinking behavior, hormone-mediated signaling pathway, kidney development, male gonad development, mesonephros development, proteolysis, regulation of blood pressure, regulation of MAPK cascade, renin-angiotensin regulation of aldosterone production, response to cAMP, response to cGMP, response to immobilization stress, response to lipopolysaccharide 2016271 43 24:66 LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKR
PSQ00711 FD00165 Parathyroid hormone P01270 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 hormone activity, parathyroid hormone receptor binding, peptide hormone receptor binding, protein N-terminus binding, receptor ligand activity, type 1 parathyroid hormone receptor binding 120 Parathormone, Parathyrin PTH 9606 extracellular region, extracellular space activation of phospholipase C activity, adenylate cyclase-activating G protein-coupled receptor signaling pathway, bone resorption, cAMP metabolic process, cell-cell signaling, cellular calcium ion homeostasis, cellular macromolecule biosynthetic process, G protein-coupled receptor signaling pathway, homeostasis of number of cells within a tissue, hormone-mediated apoptotic signaling pathway, magnesium ion homeostasis, negative regulation of apoptotic process in bone marrow cell, negative regulation of bone mineralization involved in bone maturation, negative regulation of chondrocyte differentiation, negative regulation of gene expression, negative regulation of inflammatory response to antigenic stimulus, phosphate ion homeostasis, positive regulation of bone mineralization, positive regulation of cell proliferation in bone marrow, positive regulation of glucose import, positive regulation of glycogen biosynthetic process, positive regulation of inositol phosphate biosynthetic process, positive regulation of osteoclast proliferation, positive regulation of signal transduction, positive regulation of transcription by RNA polymerase II, regulation of gene expression, response to cadmium ion, response to drug, response to ethanol, response to fibroblast growth factor, response to lead ion, response to parathyroid hormone, response to vitamin D, Rho protein signal transduction, skeletal system development 4521809 6 26:31 KSVKKR
PSQ00712 FD00432 Pro-glucagon P01275 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 glucagon receptor binding, hormone activity, identical protein binding, signaling receptor binding 180 None GCG 9606 endoplasmic reticulum lumen, extracellular region, extracellular space, secretory granule lumen adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to glucagon stimulus, feeding behavior, G protein-coupled receptor signaling pathway, glucose homeostasis, negative regulation of apoptotic process, negative regulation of execution phase of apoptosis, negative regulation of inflammatory response to antigenic stimulus, positive regulation of calcium ion import, positive regulation of ERK1 and ERK2 cascade, positive regulation of gluconeogenesis, positive regulation of histone H3-K4 methylation, positive regulation of insulin secretion involved in cellular response to glucose stimulus, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of protein binding, positive regulation of protein kinase activity, protein kinase A signaling, regulation of insulin secretion, response to activity 2753890 6 84:89 NRNNIA
PSQ00713 FD00096 Somatoliberin P01286 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding 108 Growth hormone-releasing factor, Growth hormone-releasing hormone, Somatocrinin, Somatorelin GHRH 9606 extracellular region, extracellular space, perikaryon, terminal bouton adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell-cell signaling, G protein-coupled receptor signaling pathway, growth hormone secretion, negative regulation of inflammatory response to antigenic stimulus, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, REM sleep, positive regulation of growth hormone secretion, positive regulation of insulin-like growth factor receptor signaling pathway, positive regulation of multicellular organism growth, response to food 6812220 11 21:31 PPPPLTLRMRR
PSQ00722 FD00092 Interleukin-1 alpha P01583 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 112 copper ion binding, cytokine activity, interleukin-1 receptor binding 271 Hematopoietin-1 IL1A 9606 cytosol, extracellular region, extracellular space apoptotic process, cellular response to heat, cellular response to lipopolysaccharide, cellular sodium ion homeostasis, connective tissue replacement involved in inflammatory response wound healing, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, immune response, inflammatory response, interleukin-1-mediated signaling pathway, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of angiogenesis, positive regulation of cell division, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of protein secretion, positive regulation of transcription by RNA polymerase II, positive regulation of tumor necrosis factor production, positive regulation of vascular endothelial growth factor production, regulation of nitric-oxide synthase activity, response to copper ion 3281727 112 1:112 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPR
PSQ00723 FD00092 Interleukin-1 beta P01584 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 116 cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding 269 Catabolin IL1B 9606 cytosol, extracellular region, extracellular space, lysosome activation of MAPK activity, apoptotic process, cell-cell signaling, cellular response to drug, cellular response to lipopolysaccharide, cellular response to mechanical stimulus, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, embryo implantation, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, lipopolysaccharide-mediated signaling pathway, MAPK cascade, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of glucose transmembrane transport, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neurogenesis, negative regulation of synaptic transmission, positive regulation of angiogenesis, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell adhesion molecule production, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of complement activation, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of histone acetylation, positive regulation of histone phosphorylation, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuroinflammatory response, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein export from nucleus, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of T cell mediated immunity, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, positive regulation of vascular endothelial growth factor receptor signaling pathway, protein kinase B signaling, purinergic nucleotide receptor signaling pathway, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, signal transduction, smooth muscle adaptation, vascular endothelial growth factor production 3281727, 3920526 116 1:116 MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHD
PSQ00724 FD00127 Collagen alpha-1(I) chain P02452 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 139 extracellular matrix structural constituent, extracellular matrix structural constituent conferring tensile strength, identical protein binding, metal ion binding, platelet-derived growth factor binding, protease binding 1464 Alpha-1 type I collagen COL1A1 9606 collagen type I trimer, collagen-containing extracellular matrix, cytoplasm, endoplasmic reticulum lumen, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, secretory granule blood coagulation, blood vessel development, bone trabecula formation, cartilage development involved in endochondral bone morphogenesis, cellular response to amino acid stimulus, cellular response to epidermal growth factor stimulus, cellular response to fibroblast growth factor stimulus, cellular response to fluoride, cellular response to mechanical stimulus, cellular response to retinoic acid, cellular response to transforming growth factor beta stimulus, cellular response to tumor necrosis factor, cellular response to vitamin E, collagen biosynthetic process, collagen fibril organization, collagen-activated tyrosine kinase receptor signaling pathway, embryonic skeletal system development, endochondral ossification, extracellular matrix organization, face morphogenesis, intramembranous ossification, leukocyte migration, negative regulation of cell-substrate adhesion, ossification, osteoblast differentiation, platelet activation, positive regulation of canonical Wnt signaling pathway, positive regulation of cell migration, positive regulation of epithelial to mesenchymal transition, positive regulation of transcription, DNA-templated, protein localization to nucleus, protein transport, regulation of immune response, response to cAMP, response to corticosteroid, response to drug, response to estradiol, response to hydrogen peroxide, response to hyperoxia, response to mechanical stimulus, response to peptide hormone, sensory perception of sound, skeletal system development, skin development, skin morphogenesis, tooth eruption, tooth mineralization, visual perception 5529814 139 23:161 QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP