Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ01401 | FD00123 | Lipase | P61872 | Eukaryota Fungi Fungi incertae sedis Mucoromycota Mucoromycotina Mucoromycetes Mucorales Mucorineae Rhizopodaceae Rhizopus | Rhizopus oryzae (Mucormycosis agent) (Rhizopus arrhizus var | 69 | metal ion binding, triglyceride lipase activity | 392 | RDL, Triacylglycerol lipase | None | 64495 | extracellular space | lipid catabolic process | 11506890 | 69 | 27:95 | VPVSGKSGSSNTAVSASDNAALPPLISSRCAPPSNKGSKSDLQAEPYNMQKNTEWYESHGGNLTSIGKR | |
PSQ01402 | FD00091 | DELTA-actitoxin-Aeq1a | P61914 | Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Actiniidae Actinia | Actinia equina (Beadlet anemone) | 16 | channel activity, toxin activity | 214 | Equinatoxin II , Equinatoxin-2 | None | 6106 | extracellular region, nematocyst, other organism cell membrane, pore complex | cation transport, hemolysis in other organism involved in symbiotic interaction, pore complex assembly | 7912550 | 16 | 20:35 | LPSKKIIDEDEEDEKR | |
PSQ01403 | FD00137 | RNA polymerase sigma-35 factor | P62179 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group | Bacillus thuringiensis subsp | 27 | DNA binding, DNA-binding transcription factor activity, sigma factor activity | 240 | None | sigE | 29339 | None | DNA-templated transcription, initiation, sporulation resulting in formation of a cellular spore | 1904859 | 27 | 1:27 | MMKLKFYLVYLWYKVLLKLGIKTDEIY | |
PSQ01404 | FD00346 | RNA polymerase sigma-28 factor | P62181 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group | Bacillus thuringiensis subsp | 19 | DNA binding, DNA-binding transcription factor activity, sigma factor activity | 240 | None | sigK | 29339 | None | DNA-templated transcription, initiation, sporulation resulting in formation of a cellular spore | 1904859 | 19 | 1:19 | MSLFAAIGYMVREVFVFVS | |
PSQ01405 | FD00003 | Glacontryphan-M | P62903 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus | Conus marmoreus (Marble cone) | 28 | ion channel inhibitor activity, metal ion binding, toxin activity | 63 | None | None | 42752 | extracellular region | pathogenesis | 15155730 | 28 | 24:51 | DRDQPADRNAVPRDDNPGRARRKRMKVL | |
PSQ01406 | FD00526 | Albumin-1 D | P62929 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum | Pisum sativum (Garden pea) | 6 | nutrient reservoir activity, toxin activity | 130 | PA1 D, PsaA1b012 | None | 3888 | None | pathogenesis | 3755437 | 6 | 64:69 | VFLKAN | |
PSQ01407 | FD00096 | Somatoliberin | P63292 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos | Bos taurus (Bovine) | 11 | growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding | 106 | Growth hormone-releasing factor, Growth hormone-releasing hormone | GHRH | 9913 | extracellular space, perikaryon, terminal bouton | adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cellular response to calcium ion, growth hormone secretion, positive regulation of cell population proliferation, positive regulation of G protein-coupled receptor signaling pathway, positive regulation of growth hormone secretion, positive regulation of insulin secretion, positive regulation of lactation, positive regulation of multicellular organism growth, response to food | 6421287 | 11 | 20:30 | SLPSQPLRIPR | |
PSQ01408 | FD00135 | Secretin | P63298 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus | Sus scrofa (Pig) | 10, 72 | digestive hormone activity, hormone activity, signaling receptor binding | 134 | None | SCT | 9823 | extracellular space | brain development, cellular water homeostasis, diet induced thermogenesis, hippocampus development, negative regulation of gastrin-induced gastric acid secretion, positive regulation of lipid catabolic process, positive regulation of pancreatic juice secretion, positive regulation of somatostatin secretion, regulation of appetite, regulation of synaptic plasticity, response to nutrient levels | 5465996;5465996 | 82 | 22:31, 63:134 | AARPAPPRAP, SQQDPENNTAWTKSGEDRLCQLWSHMPALQAWMPMKPPVDQAWSPWLPPGLRAGALVSEPAIPAAEGSPMPP | |
PSQ01409 | FD00369 | Snake venom vascular endothelial growth factor toxin VR-1 | P67861 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Daboia | Daboia russelii (Russel | 11 | growth factor activity, toxin activity | 144 | VEGF-F | None | 8707 | extracellular region, membrane | None | 14600159 | 11 | 134:144 | RGGVRAKFPFD | |
PSQ01410 | FND00226 | Omega-theraphotoxin-Hs1a | P68424 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) | 20 | toxin activity | 68 | Huwentoxin-10, Huwentoxin-X | None | 29017 | extracellular region | None | 16439354 | 20 | 21:40 | ERHSKTDMEDMEDSPMIQER | |
PSQ01411 | FD00175 | Kunitz-type kappaPI-theraphotoxin-Hs1a | P68425 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma | Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) | 6 | serine-type endopeptidase inhibitor activity, toxin activity | 88 | Huwentoxin-11g8, Huwentoxin-XI, Kunitz-type serine protease inhibitor huwentoxin-11 | None | 29017 | extracellular region | None | 15066414, 18923708 | 6 | 28:33 | DHHDGR | |
PSQ01412 | FD00377 | SPbeta prophage-derived bacteriocin sublancin-168 | P68577 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus subtilis (strain 168) | 19 | None | 60 | None | sunA | 224308 | extracellular region | cytolysis, defense response to Gram-positive bacterium | 9722542 | 19 | 1:19 | MEKLFKEVKLEELENQKGS | |
PSQ01413 | FND00014 | Aurein-2 | P69019 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Ranoidea | Ranoidea aurea (Green and golden bell frog) (Litoria aurea) | 27 | lipid binding | 72 | None | None | 8371 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, defense response to fungus, killing of cells of other organism | 10951191 | 27 | 23:49 | EKEKRQNEEDEDENEAANHEEGSEEKR | |
PSQ01414 | FND00014 | Aurein-3 | P69021 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Ranoidea | Ranoidea aurea (Green and golden bell frog) (Litoria aurea) | 27 | None | 70 | None | None | 8371 | extracellular region, membrane, other organism cell membrane | defense response to bacterium, innate immune response | 10951191 | 27 | 23:49 | EKEKRQNEEDEDENEAANHEEGSEEKR | |
PSQ01415 | FND00112 | Aurein-5 | P69031 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Ranoidea | Ranoidea aurea (Green and golden bell frog) (Litoria aurea) | 24 | None | 71 | Aurein-5 | None | 8371 | extracellular region, membrane, other organism cell membrane | defense response to bacterium | 15721491 | 24 | 23:46 | EQEKREEENQEEDEENEAASEEKR | |
PSQ01416 | FD00199 | Archaerhodopsin-1 | P69051 | Archaea Euryarchaeota Stenosarchaea group Halobacteria Haloferacales Halorubraceae Halorubrum | Halorubrum chaoviator (strain DSM 11365 | 6 | ion channel activity, photoreceptor activity | 260 | None | None | 335819 | integral component of membrane, plasma membrane | phototransduction, protein-chromophore linkage | 2833260 | 6 | 1:6 | MDPIAL | |
PSQ01417 | FD00528 | Glucoamylase | P69328 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati | Aspergillus niger | 6 | glucan 1,4-alpha-glucosidase activity, starch binding | 640 | 1, Glucan 1 | GLAA | 5061 | endoplasmic reticulum | polysaccharide catabolic process, polysaccharide metabolic process | 3081341 | 6 | 19:24 | NVISKR | |
PSQ01418 | FND00163 | Alpha-pompilidotoxin | P69391 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Pompiloidea Pompilidae Pompilinae Anoplius | Anoplius samariensis (Solitary wasp) | 20 | toxin activity | 60 | None | None | 200614 | extracellular region | None | 9784394 | 20 | 23:42 | EPAAEPNANAEPLAEASAEP | |
PSQ01419 | FND00006 | Conantokin-L | P69745 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Phasmoconus | Conus lynceus (Lynceus cone) | 59 | metal ion binding, toxin activity | 101 | None | None | 289038 | extracellular region, host cell postsynaptic membrane | pathogenesis | 12350383 | 59 | 22:80 | TGTLDHGGALTERRSTDAIALKPEPVLLQKSSARSTDDNGNDRLTQMKRILKKRGNKAR | |
PSQ01420 | FD00014 | Conotoxin vc5a | P69765 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder | Conus victoriae (Queen Victoria cone) | 28 | toxin activity | 60 | Vc5 | None | 319920 | extracellular region | None | 15170751 | 28 | 15:42 | RLKAKDNMPLASFHDNAKRTLQTRLINT | |
PSQ01421 | FD00060 | Delta-actitoxin-Amc2a | P69930 | Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Actiniidae Antheopsis | Antheopsis maculata (Sea anemone) | 11 | ion channel inhibitor activity, toxin activity | 80 | Peptide toxin Am II , Peptide toxin Am-2 | None | 280228 | extracellular region, nematocyst | pathogenesis | 15581681 | 11 | 20:30 | AEEEYVERAPV | |
PSQ01422 | FD00114 | Potassium channel toxin TsTXK-beta | P69940 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Tityus | Tityus serrulatus (Brazilian scorpion) | 8 | toxin activity | 87 | Potassium channel toxin beta-KTx 1, Tityustoxin K-beta, Ts8 , TsK2 | None | 6887 | extracellular region | None | 7509073 | 8 | 20:27 | GLREKHVQ | |
PSQ01423 | FD00080 | Guanylate cyclase activator 2B | P70668 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 70 | guanylate cyclase activator activity | 106 | None | Guca2b | 10116 | extracellular region, photoreceptor outer segment | body fluid secretion, cGMP-mediated signaling, excretion, negative regulation of blood pressure, water homeostasis | 9094754 | 70 | 22:91 | VYIKYHGFQVQLESVKKLNELEEKQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIA | |
PSQ01424 | FD00158 | Pyrolysin | P72186 | Archaea Euryarchaeota Thermococci Thermococcales Thermococcaceae Pyrococcus | Pyrococcus furiosus (strain ATCC 43587 | 123 | serine-type endopeptidase activity | 1398 | None | pls | 186497 | envelope | None | 8702780 | 123 | 27:149 | GTPPVSSENSTTSILPNQQVVTKEVSQAALNAIMKGQPNMVLIIKTKEGKLEEAKTELEKLGAEILDENRVLNMLLVKIKPEKVKELNYISSLEKAWLNREVKLSPPIVEKDVKTKEPSLEPK | |
PSQ01425 | FD00314 | Lys-gingipain 381 | P72194 | Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas | Porphyromonas gingivalis | 204 | calcium ion binding, cysteine-type endopeptidase activity | 1723 | None | kgp | 837 | extracellular region | hemolysis in other organism, pathogenesis, proteolysis | 8889827 | 204 | 25:228 | KLDAPTTRTTCTNNSFKQFDASFSFNEVELTKVETKGGTFASVSIPGAFPTGEVGSPEVPAVRKLIAVPVGATPVVRVKSFTEQVYSLNQYGSEKLMPHQPSMSKSDDPEKVPFVYNAAAYARKGFVGQELTQVEMLGTMRGVRIAALTINPVQYDVVANQLKVRNNIEIEVSFQGADEVATQRLYDASFSPYFETAYKQLFNR | |
PSQ01426 | FD00416 | Disintegrin and metalloproteinase domain-containing protein 17 | P78536 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 197 | endopeptidase activity, integrin binding, interleukin-6 receptor binding, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, Notch binding, PDZ domain binding, peptidase activity, SH3 domain binding | 824 | Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme | ADAM17 | 9606 | actin cytoskeleton, apical plasma membrane, cell surface, cytoplasm, cytosol, endoplasmic reticulum lumen, Golgi membrane, integral component of plasma membrane, membrane, membrane raft, plasma membrane | amyloid precursor protein catabolic process, B cell differentiation, cell adhesion, cell adhesion mediated by integrin, cell motility, cellular response to high density lipoprotein particle stimulus, defense response to Gram-positive bacterium, epidermal growth factor receptor signaling pathway, germinal center formation, membrane protein ectodomain proteolysis, membrane protein intracellular domain proteolysis, negative regulation of cold-induced thermogenesis, negative regulation of inflammatory response to antigenic stimulus, negative regulation of transforming growth factor beta receptor signaling pathway, neutrophil mediated immunity, Notch receptor processing, Notch signaling pathway, positive regulation of blood vessel endothelial cell migration, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of cellular component movement, positive regulation of chemokine production, positive regulation of cyclin-dependent protein serine/threonine kinase activity, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of G1/S transition of mitotic cell cycle, positive regulation of leukocyte chemotaxis, positive regulation of protein phosphorylation, positive regulation of T cell chemotaxis, positive regulation of transforming growth factor beta receptor signaling pathway, positive regulation of tumor necrosis factor-mediated signaling pathway, positive regulation of vascular endothelial cell proliferation, protein processing, proteolysis, receptor transactivation, regulation of mast cell apoptotic process, response to drug, response to hypoxia, response to lipopolysaccharide, spleen development, T cell differentiation in thymus, tumor necrosis factor-mediated signaling pathway, wound healing, spreading of epidermal cells | 9034191 | 197 | 18:214 | PRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKR | |
PSQ01427 | FD00030 | Penicillopepsin-2 | P78735 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium | Penicillium janthinellum (Penicillium vitale) | 51 | aspartic-type endopeptidase activity | 394 | Aspartic protease pepA, Penicillopepsin-JT2 | pepA | 5079 | extracellular region | None | 10850809 | 51 | 21:71 | VPTGTSRKSTFTVNQKARPVAQAKAINLPGMYASALSKYGAAVPASVKAAA | |
PSQ01428 | FD00100 | Pyranose 2-oxidase | P79076 | Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Polyporales Polyporaceae Trametes | Trametes versicolor (White-rot fungus) (Coriolus versicolor) | 11 | flavin adenine dinucleotide binding, pyranose oxidase activity | 623 | FAD-oxidoreductase, Glucose 2-oxidase, Pyranose | P2OX | 5325 | periplasmic space | None | 9025322 | 11 | 28:38 | TSLPPLPGPDK | |
PSQ01429 | FND00001 | Temporin-1Tb | P79874 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana | Rana temporaria (European common frog) | 22 | lipid binding | 61 | Temporin-B | None | 8407 | extracellular region, membrane, other organism cell membrane | defense response to fungus, defense response to Gram-positive bacterium, innate immune response, killing of cells of other organism, regulation of defense response to virus | 9022710 | 22 | 23:44 | EEERNAEEERRDEPDERDVQVE | |
PSQ01430 | FND00001 | Temporin-1Tg | P79875 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana | Rana temporaria (European common frog) | 22 | None | 61 | Temporin-G | None | 8407 | extracellular region | defense response to bacterium, innate immune response | 9022710 | 22 | 23:44 | EEERDADEERRDDLEERDVEVE | |
PSQ01431 | FND00001 | Temporin-1Th | P79876 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana | Rana temporaria (European common frog) | 24 | None | 60 | Temporin-H | None | 8407 | extracellular region | defense response to bacterium, innate immune response | 9022710 | 24 | 23:46 | EEERNAEEERRDEPDERDVQVEKR | |
PSQ01432 | FD00581 | Ovochymase-2 | P79953 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus | Xenopus laevis (African clawed frog) | 26 | metal ion binding, serine-type endopeptidase activity | 1004 | Oviductal protease, Oviductin | ovch2 | 8355 | extracellular region | None | 10084976 | 26 | 20:45 | DPGPHRGARCGVSPLGSATELNYLSR | |
PSQ01433 | FD00004 | Azurocidin | P80015 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus | Sus scrofa (Pig) | 7 | heparan sulfate proteoglycan binding, heparin binding, serine-type endopeptidase activity | 246 | Cationic antimicrobial protein CAP37 , Heparin-binding protein | AZU1 | 9823 | azurophil granule, azurophil granule membrane, extracellular space, extrinsic component of membrane | antimicrobial humoral response, calcium-mediated signaling using intracellular calcium source, cell chemotaxis, defense response to virus, glial cell migration, microglial cell activation, neutrophil-mediated killing of bacterium, positive regulation of cell adhesion, positive regulation of fractalkine production, positive regulation of interleukin-1 beta production, positive regulation of MHC class II biosynthetic process, positive regulation of peptidyl-threonine phosphorylation, positive regulation of phagocytosis, positive regulation of protein kinase activity, positive regulation of tumor necrosis factor production, protein kinase C signaling | 2026172 | 7 | 20:26 | GLATLAD | |
PSQ01434 | FD00069 | Lactoperoxidase | P80025 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos | Bos taurus (Bovine) | 78 | calcium ion binding, heme binding, peroxidase activity, thiocyanate peroxidase activity | 719 | None | LPO | 9913 | extracellular space | antibacterial humoral response, defense response to bacterium, hydrogen peroxide catabolic process, response to oxidative stress | 2050150 | 78 | 23:100 | DTIAQAASTTTISDAVSKVKIQVNKAFLDSRTRLKTTLSSEAPTTQQLSEYFKHAKGRTRTAIRNGQVWEESLKRLRR | |
PSQ01435 | FD00023 | Antibacterial protein PR-39 | P80054 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus | Sus scrofa (Pig) | 101 | lipopolysaccharide binding | 179 | None | PR39 | 9823 | extracellular space | antimicrobial humoral immune response mediated by antimicrobial peptide, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response | 1765098, 7996056 | 101 | 30:130 | QALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLNPSIHSLDISCNEIQSV | |
PSQ01436 | FD00066 | Glutamyl endopeptidase | P80057 | Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus | Bacillus licheniformis (strain ATCC 14580 , | 64 | serine-type endopeptidase activity | 316 | Glutamate-specific endopeptidase | blaSE | 279010 | extracellular region | None | 1346764 | 64 | 31:94 | APSPHTPVSSDPSYKAETSVTYDPNIKSDQYGLYSKAFTGTGKVNETKEKAEKKSPAKAPYSIK | |
PSQ01437 | FD00566 | Beta-fructofuranosidase | P80065 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids campanulids Apiales Apiaceae Apioideae Scandiceae Daucinae Daucus Daucus sect Daucus | Daucus carota (Wild carrot) | 115 | sucrose alpha-glucosidase activity | 661 | Invertase, Saccharase, Sucrose hydrolase | INV | 4039 | integral component of membrane, vacuolar lumen | carbohydrate metabolic process | 1541302 | 115 | 1:115 | MDTYHFLPSRDLEHASSYTPRPDSPETRHEPDPDRSKTNRRPIKIVSSVLLSTLILSFVIFLLVNPNVQQVVRKKVSKNSNGEDRNKASKSPEMLGPPSRGVSQGVSEKSFRQAT | |
PSQ01438 | FD00055 | Gastrin | P80111 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Lithobates | Lithobates catesbeianus (American bullfrog) (Rana catesbeiana) | 25 | hormone activity | 102 | Antral peptide | GAST | 8400 | extracellular region | digestion | 1633800 | 25 | 21:45 | RPMTELESARHGAQRKNSISDVSRR | |
PSQ01439 | FD00011 | Extracellular serine proteinase | P80146 | Bacteria Deinococcus-Thermus Deinococci Thermales Thermaceae Thermus unclassified Thermus | Thermus sp | 113 | serine-type endopeptidase activity | 410 | None | None | 32063 | extracellular region | None | 1499549 | 113 | 20:132 | SNPPAASTQEAPLLGLEAPEAIPGRYIVVYKENADVLPALEALKAALEPGLMQPQGLQAQALRTLGLEGARVDKVYTAALRGVAVEVPDQELARLRQDPRVAYIEADQEVRAF | |
PSQ01440 | FD00344 | Intracellular ribonuclease LX | P80196 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen Lycopersicon | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) | 24 | endoribonuclease activity, lyase activity, ribonuclease T2 activity, RNA binding | 240 | None | RNALX | 4081 | cytoplasm, extracellular region | RNA catabolic process | 8319673 | 24 | 1:24 | MMKSQKKLLIKIIVVQCLLVLCVT | |
PSQ01441 | FD00552 | Cathepsin D | P80209 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos | Bos taurus (Bovine) | 44 | aspartic-type endopeptidase activity | 390 | None | CTSD | 9913 | extracellular space, lysosome, melanosome | None | 8467789 | 44 | 1:44 | VIRIPLHKFTSIRRTMSEAAGXVXXLIAKGPISKYATGEPAVRQ | |
PSQ01442 | FND00273 | Bacteriocin plantaricin-A | P80214 | Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactiplantibacillus | Lactobacillus plantarum (strain ATCC BAA-793 | 25 | None | 48 | None | plnA | 220668 | None | cytolysis, defense response to bacterium | 8245827 | 25 | 1:25 | MKIQIKGMKQLSNKEMQKIVGGKSS | |
PSQ01443 | FND00024 | Dermaseptin-B1 | P80282 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa | Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) | 20 | None | 78 | Dermaseptin BI | None | 8393 | extracellular region | defense response to bacterium, defense response to fungus, killing of cells of other organism | 8306981 | 20 | 23:42 | EEEKRENEDEEKQDDEQSEM | |
PSQ01444 | FD00081 | Gaegurin-4 | P80398 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Glandirana | Glandirana rugosa (Japanese wrinkled frog) (Rana rugosa) | 21 | None | 80 | None | GGN4 | 8410 | extracellular region | defense response to bacterium | 7999137 | 21 | 23:43 | EEERSADEDDGGEMTEEEVKR | |
PSQ01445 | FD00266 | Photosystem II core complex proteins psbY | P80470 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Chenopodiaceae Chenopodioideae Anserineae Spinacia | Spinacia oleracea (Spinach) | 26 | manganese ion binding | 199 | L-arginine-metabolizing enzyme | PSBY | 3562 | chloroplast thylakoid membrane, integral component of membrane, photosystem II | photosynthesis | 9829828 | 26 | 129:154 | KAFIVGLGLSGLATSGLLLATPEAQA | |
PSQ01446 | FD00491 | Aminopeptidase S | P80561 | Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces | Streptomyces griseus subsp | 116 | aminopeptidase activity, metal ion binding, serine-type endopeptidase activity | 445 | API , SGAP | None | 455632 | extracellular region | None | 8665903 | 116 | 330:445 | GEGVFSNTTDVAIPDAGAAVTSSVAVTGRTGNAPAALQVGVDIKHTYRGDLVVDLLAPDGTAYRLKNSSSGDSADNVIATYTVNASSEVANGSWKLRVQDIARQDTGYIDSWKLTF | |
PSQ01447 | FD00074 | Bacteriocin piscicolin-126 | P80569 | Bacteria Firmicutes Bacilli Lactobacillales Carnobacteriaceae Carnobacterium | Carnobacterium maltaromaticum (Carnobacterium piscicola) | 18 | None | 62 | None | pisA | 2751 | extracellular region | cytolysis, defense response to bacterium | 8702282 | 18 | 1:18 | MKTVKELSVKEMQLTTGG | |
PSQ01448 | FND00095 | Bacteriocin amylovorin-L | P80696 | Bacteria Firmicutes Bacilli Lactobacillales Lactobacillaceae Lactobacillus | Lactobacillus amylovorus | 15 | None | 65 | Amylovorin-L471, Lactobin-A | amyL | 1604 | extracellular region, host cell plasma membrane, integral component of membrane | cytolysis, defense response to bacterium | 10517609, 8979334 | 15 | 1:15 | MKQLNSEQLQNIIGG | |
PSQ01449 | FND00115 | 11.9 kDa wall protein | P80708 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Pezizomycetes Pezizales Tuberaceae Tuber | Tuber borchii (White truffle) | 12 | None | 120 | TB 11 | TBF-1 | 42251 | cell wall, extracellular region | None | 9974220 | 12 | 1:12 | MSSKIVREPATK | |
PSQ01450 | FD00090 | Clavanin-A | P80710 | Eukaryota Metazoa Chordata Tunicata Ascidiacea Stolidobranchia Styelidae Styela | Styela clava (Sea squirt) | 10 | None | 80 | None | None | 7725 | extracellular region | defense response to bacterium | 9001389 | 10 | 20:29 | LEERKSEEEK |