Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01265

ProSeqID PSQ01265
Family FD00284
Protein Name Prepilin peptidase-dependent protein D
UniProt ID P36647
Taxonomy Bacteria-Proteobacteria-Gammaproteobacteria-Enterobacterales-Enterobacteriaceae-Escherichia
Organisms Escherichia coli (strain K12)
Prosequence Length (aa) 6
Functions None
Preproprotein Length (aa) 146
Alt Name None
Gene Name ppdD
NCBI ID 83333
Cellular Localization integral component of membrane, type IV pilus
Processes type IV pilus biogenesis, type IV pilus-dependent motility
PubMed 10633126
Total Prosequence Length (aa) 6
Prosequence Location 1:6
Prosequence Sequence MDKQRG
Preproprotein Sequence MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQTFVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLSVVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN