Details of PSQ01262
| ProSeqID |
PSQ01262 |
| Family |
FD00036 |
| Protein Name |
Lantibiotic salivaricin-A |
| UniProt ID |
P36500
|
| Taxonomy |
Bacteria-Firmicutes-Bacilli-Lactobacillales-Streptococcaceae-Streptococcus |
| Organisms |
Streptococcus salivarius |
| Prosequence Length (aa) |
26 |
| Functions |
signaling receptor binding |
| Preproprotein Length (aa) |
48 |
| Alt Name |
None |
| Gene Name |
salA |
| NCBI ID |
1304 |
| Cellular Localization |
extracellular region |
| Processes |
cytolysis, defense response to bacterium |
| PubMed |
8357242
|
| Total Prosequence Length (aa) |
26 |
| Prosequence Location |
1:26 |
| Prosequence Sequence |
MKNSKDILNNAIEEVSEKELMEVAGG |
| Preproprotein Sequence |
MKNSKDILNNAIEEVSEKELMEVAGGKRGSGWIATITDDCPNSVFVCC |